Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 1392979..1393639 | Replicon | chromosome |
Accession | NZ_LR698987 | ||
Organism | Leminorella richardii isolate MGYG-HGUT-02385 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | FX055_RS06515 | Protein ID | WP_111739947.1 |
Coordinates | 1392979..1393332 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | FX055_RS06520 | Protein ID | WP_111739948.1 |
Coordinates | 1393337..1393639 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FX055_RS06495 | 1388703..1390148 | - | 1446 | WP_111739943.1 | PLP-dependent aminotransferase family protein | - |
FX055_RS06500 | 1390250..1390681 | + | 432 | WP_111739944.1 | carboxymuconolactone decarboxylase family protein | - |
FX055_RS06505 | 1390776..1391447 | + | 672 | WP_111739945.1 | MmcQ/YjbR family DNA-binding protein | - |
FX055_RS06510 | 1391533..1392696 | + | 1164 | WP_111739946.1 | winged helix-turn-helix domain-containing protein | - |
FX055_RS06515 | 1392979..1393332 | + | 354 | WP_111739947.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FX055_RS06520 | 1393337..1393639 | + | 303 | WP_111739948.1 | XRE family transcriptional regulator | Antitoxin |
FX055_RS06525 | 1394109..1394366 | + | 258 | WP_111739949.1 | antitoxin | - |
FX055_RS06530 | 1394367..1394699 | + | 333 | WP_111739950.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
FX055_RS06535 | 1395208..1396419 | + | 1212 | WP_111739951.1 | hypothetical protein | - |
FX055_RS06540 | 1396436..1398118 | + | 1683 | WP_111739952.1 | ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13482.33 Da Isoelectric Point: 7.9654
>T288711 WP_111739947.1 NZ_LR698987:1392979-1393332 [Leminorella richardii]
VWTIKTTDRFDNWFTSLSDTDRVSVLAALMILRERGPGLPRPYADTLRGSSYSNMKELRIQSRGDPIRAFFAFDLERTGI
VLCAGNKVGNEKSFYNEMLPIADREFTNWLNTLKEKE
VWTIKTTDRFDNWFTSLSDTDRVSVLAALMILRERGPGLPRPYADTLRGSSYSNMKELRIQSRGDPIRAFFAFDLERTGI
VLCAGNKVGNEKSFYNEMLPIADREFTNWLNTLKEKE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|