Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/DinJ(antitoxin) |
| Location | 1687366..1687999 | Replicon | chromosome |
| Accession | NZ_LR698953 | ||
| Organism | Bifidobacterium longum isolate MGYG-HGUT-01292 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | W6EYF0 |
| Locus tag | FXZ20_RS08415 | Protein ID | WP_012577854.1 |
| Coordinates | 1687366..1687734 (-) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | B7GS37 |
| Locus tag | FXZ20_RS08420 | Protein ID | WP_012577855.1 |
| Coordinates | 1687715..1687999 (-) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FXZ20_RS08370 | 1682996..1683253 | + | 258 | WP_012577847.1 | hypothetical protein | - |
| FXZ20_RS08375 | 1683250..1683741 | + | 492 | WP_012577848.1 | hypothetical protein | - |
| FXZ20_RS08380 | 1683887..1684291 | - | 405 | WP_014484963.1 | tyrosine-type recombinase/integrase | - |
| FXZ20_RS08385 | 1684288..1684548 | - | 261 | WP_012577849.1 | hypothetical protein | - |
| FXZ20_RS08390 | 1684703..1685047 | - | 345 | WP_012577850.1 | hypothetical protein | - |
| FXZ20_RS08395 | 1685178..1685549 | - | 372 | WP_012577851.1 | hypothetical protein | - |
| FXZ20_RS08400 | 1685656..1686411 | - | 756 | WP_012577852.1 | hypothetical protein | - |
| FXZ20_RS08405 | 1686408..1686635 | - | 228 | WP_014484964.1 | hypothetical protein | - |
| FXZ20_RS08410 | 1686632..1687177 | - | 546 | WP_012577853.1 | hypothetical protein | - |
| FXZ20_RS08415 | 1687366..1687734 | - | 369 | WP_012577854.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| FXZ20_RS08420 | 1687715..1687999 | - | 285 | WP_012577855.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| FXZ20_RS08425 | 1688075..1688374 | - | 300 | WP_012577856.1 | hypothetical protein | - |
| FXZ20_RS08430 | 1688462..1688644 | - | 183 | WP_014484966.1 | hypothetical protein | - |
| FXZ20_RS08435 | 1688644..1688985 | - | 342 | WP_012577857.1 | hypothetical protein | - |
| FXZ20_RS08440 | 1688987..1689772 | - | 786 | WP_012577858.1 | hypothetical protein | - |
| FXZ20_RS08445 | 1689971..1690312 | - | 342 | WP_012577859.1 | hypothetical protein | - |
| FXZ20_RS08450 | 1690426..1690770 | - | 345 | WP_014484967.1 | hypothetical protein | - |
| FXZ20_RS13800 | 1690767..1690928 | - | 162 | WP_155245937.1 | hypothetical protein | - |
| FXZ20_RS08455 | 1691018..1691632 | - | 615 | WP_012577862.1 | lysozyme | - |
| FXZ20_RS08460 | 1691845..1692072 | - | 228 | WP_025221588.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 1660928..1723489 | 62561 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13866.75 Da Isoelectric Point: 4.5746
>T288686 WP_012577854.1 NZ_LR698953:c1687734-1687366 [Bifidobacterium longum]
MTSTPSEPRLYDVWLMWVEFPDHPGIGKPRPVVITEVDGDLVSGIVAKITGNTDWDEAGDVPLLDWKAEGLLKPSLVRCS
QRFYFNRSELLQWFGRLSLRDAEHVNDGLEATLDIPPYRRSV
MTSTPSEPRLYDVWLMWVEFPDHPGIGKPRPVVITEVDGDLVSGIVAKITGNTDWDEAGDVPLLDWKAEGLLKPSLVRCS
QRFYFNRSELLQWFGRLSLRDAEHVNDGLEATLDIPPYRRSV
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|