288686

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/DinJ(antitoxin)
Location 1687366..1687999 Replicon chromosome
Accession NZ_LR698953
Organism Bifidobacterium longum isolate MGYG-HGUT-01292

Toxin (Protein)


Gene name mazF Uniprot ID W6EYF0
Locus tag FXZ20_RS08415 Protein ID WP_012577854.1
Coordinates 1687366..1687734 (-) Length 123 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID B7GS37
Locus tag FXZ20_RS08420 Protein ID WP_012577855.1
Coordinates 1687715..1687999 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FXZ20_RS08370 1682996..1683253 + 258 WP_012577847.1 hypothetical protein -
FXZ20_RS08375 1683250..1683741 + 492 WP_012577848.1 hypothetical protein -
FXZ20_RS08380 1683887..1684291 - 405 WP_014484963.1 tyrosine-type recombinase/integrase -
FXZ20_RS08385 1684288..1684548 - 261 WP_012577849.1 hypothetical protein -
FXZ20_RS08390 1684703..1685047 - 345 WP_012577850.1 hypothetical protein -
FXZ20_RS08395 1685178..1685549 - 372 WP_012577851.1 hypothetical protein -
FXZ20_RS08400 1685656..1686411 - 756 WP_012577852.1 hypothetical protein -
FXZ20_RS08405 1686408..1686635 - 228 WP_014484964.1 hypothetical protein -
FXZ20_RS08410 1686632..1687177 - 546 WP_012577853.1 hypothetical protein -
FXZ20_RS08415 1687366..1687734 - 369 WP_012577854.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
FXZ20_RS08420 1687715..1687999 - 285 WP_012577855.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
FXZ20_RS08425 1688075..1688374 - 300 WP_012577856.1 hypothetical protein -
FXZ20_RS08430 1688462..1688644 - 183 WP_014484966.1 hypothetical protein -
FXZ20_RS08435 1688644..1688985 - 342 WP_012577857.1 hypothetical protein -
FXZ20_RS08440 1688987..1689772 - 786 WP_012577858.1 hypothetical protein -
FXZ20_RS08445 1689971..1690312 - 342 WP_012577859.1 hypothetical protein -
FXZ20_RS08450 1690426..1690770 - 345 WP_014484967.1 hypothetical protein -
FXZ20_RS13800 1690767..1690928 - 162 WP_155245937.1 hypothetical protein -
FXZ20_RS08455 1691018..1691632 - 615 WP_012577862.1 lysozyme -
FXZ20_RS08460 1691845..1692072 - 228 WP_025221588.1 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 1660928..1723489 62561


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(16-111)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-53)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13866.75 Da        Isoelectric Point: 4.5746

>T288686 WP_012577854.1 NZ_LR698953:c1687734-1687366 [Bifidobacterium longum]
MTSTPSEPRLYDVWLMWVEFPDHPGIGKPRPVVITEVDGDLVSGIVAKITGNTDWDEAGDVPLLDWKAEGLLKPSLVRCS
QRFYFNRSELLQWFGRLSLRDAEHVNDGLEATLDIPPYRRSV

Download         Length: 369 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10472.80 Da        Isoelectric Point: 5.0057

>AT288686 WP_012577855.1 NZ_LR698953:c1687999-1687715 [Bifidobacterium longum]
MGKLVANIDDDVKARAAALYDSMGMSLSTAVNMFLRQSLVDNGLPFKPTRHTPDGYPVPPVHNAYMFERSEKGHVILPAD
WNDSEDAVYDQYAK

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB W6EYF0

Antitoxin

Source ID Structure
AlphaFold DB B7GS37

References