Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2721205..2721541 | Replicon | chromosome |
| Accession | NZ_LR698844 | ||
| Organism | Enterococcus faecalis isolate MGYG-HGUT-01694 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | E2Z0W4 |
| Locus tag | FXY61_RS13325 | Protein ID | WP_002381035.1 |
| Coordinates | 2721205..2721348 (+) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2721492..2721541 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FXY61_RS13305 | 2717297..2717935 | - | 639 | WP_015212268.1 | lytic polysaccharide monooxygenase | - |
| FXY61_RS13310 | 2718621..2720237 | + | 1617 | WP_015212269.1 | phosphatase PAP2/LCP family protein | - |
| FXY61_RS13315 | 2720566..2720715 | + | 150 | WP_002411240.1 | putative holin-like toxin | - |
| FXY61_RS13320 | 2720834..2720974 | + | 141 | WP_073340360.1 | putative holin-like toxin | - |
| FXY61_RS13325 | 2721205..2721348 | + | 144 | WP_002381035.1 | putative holin-like toxin | Toxin |
| - | 2721492..2721541 | + | 50 | - | - | Antitoxin |
| FXY61_RS13330 | 2721543..2725370 | - | 3828 | WP_002389430.1 | WxL domain-containing protein | - |
| FXY61_RS13335 | 2725357..2725719 | - | 363 | WP_002378868.1 | LPXTG cell wall anchor domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5202.20 Da Isoelectric Point: 10.0041
>T288682 WP_002381035.1 NZ_LR698844:2721205-2721348 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKENNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKENNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT288682 NZ_LR698844:2721492-2721541 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|