Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5363210..5363805 | Replicon | chromosome |
Accession | NZ_LR657304 | ||
Organism | Pseudomonas aeruginosa PAK |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | PAKAF_RS24755 | Protein ID | WP_003113526.1 |
Coordinates | 5363527..5363805 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PAKAF_RS24750 | Protein ID | WP_003113527.1 |
Coordinates | 5363210..5363515 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAKAF_RS24720 | 5358880..5359170 | - | 291 | WP_016253916.1 | DUF5447 family protein | - |
PAKAF_RS24725 | 5359382..5359654 | - | 273 | WP_003115921.1 | hypothetical protein | - |
PAKAF_RS24730 | 5359764..5360030 | + | 267 | WP_016253917.1 | hypothetical protein | - |
PAKAF_RS24735 | 5360086..5360421 | + | 336 | WP_031759015.1 | hypothetical protein | - |
PAKAF_RS24740 | 5360456..5361601 | + | 1146 | WP_016253918.1 | DUF262 domain-containing protein | - |
PAKAF_RS24745 | 5361604..5362371 | + | 768 | WP_016253919.1 | hypothetical protein | - |
PAKAF_RS24750 | 5363210..5363515 | - | 306 | WP_003113527.1 | HigA family addiction module antidote protein | Antitoxin |
PAKAF_RS24755 | 5363527..5363805 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PAKAF_RS24760 | 5364134..5366362 | + | 2229 | WP_016253920.1 | TonB-dependent receptor | - |
PAKAF_RS24765 | 5366432..5367076 | - | 645 | WP_016253921.1 | carbonate dehydratase | - |
PAKAF_RS24770 | 5367138..5368376 | - | 1239 | WP_016253922.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T288662 WP_003113526.1 NZ_LR657304:c5363805-5363527 [Pseudomonas aeruginosa PAK]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|