Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/DinJ(antitoxin)
Location 1401461..1402094 Replicon chromosome
Accession NZ_LR655210
Organism Bifidobacterium longum subsp. infantis isolate B.longum_ssp_infantis_6

Toxin (Protein)


Gene name mazF Uniprot ID W6EYF0
Locus tag BILO16373828_RS06385 Protein ID WP_012577854.1
Coordinates 1401726..1402094 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID B7GS37
Locus tag BILO16373828_RS06380 Protein ID WP_012577855.1
Coordinates 1401461..1401745 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BILO16373828_RS06340 1397388..1397615 + 228 WP_025221588.1 helix-turn-helix domain-containing protein -
BILO16373828_RS06345 1397828..1398442 + 615 WP_012577862.1 lysozyme -
BILO16373828_RS13735 1398532..1398693 + 162 WP_155245937.1 hypothetical protein -
BILO16373828_RS06350 1398690..1399034 + 345 WP_014484967.1 hypothetical protein -
BILO16373828_RS06355 1399148..1399489 + 342 WP_012577859.1 hypothetical protein -
BILO16373828_RS06360 1399688..1400473 + 786 WP_012577858.1 hypothetical protein -
BILO16373828_RS06365 1400475..1400816 + 342 WP_012577857.1 hypothetical protein -
BILO16373828_RS06370 1400816..1400998 + 183 WP_014484966.1 hypothetical protein -
BILO16373828_RS06375 1401086..1401385 + 300 WP_012577856.1 hypothetical protein -
BILO16373828_RS06380 1401461..1401745 + 285 WP_012577855.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
BILO16373828_RS06385 1401726..1402094 + 369 WP_012577854.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
BILO16373828_RS06390 1402283..1402828 + 546 WP_012577853.1 hypothetical protein -
BILO16373828_RS06395 1402825..1403052 + 228 WP_014484964.1 hypothetical protein -
BILO16373828_RS06400 1403049..1403804 + 756 WP_012577852.1 hypothetical protein -
BILO16373828_RS06405 1403911..1404282 + 372 WP_012577851.1 hypothetical protein -
BILO16373828_RS06410 1404413..1404757 + 345 WP_012577850.1 hypothetical protein -
BILO16373828_RS06415 1404912..1405172 + 261 WP_012577849.1 hypothetical protein -
BILO16373828_RS06420 1405169..1405573 + 405 WP_014484963.1 tyrosine-type recombinase/integrase -
BILO16373828_RS06425 1405719..1406210 - 492 WP_012577848.1 hypothetical protein -
BILO16373828_RS06430 1406207..1406464 - 258 WP_012577847.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 1365971..1428532 62561


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(16-111)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(5-53)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13866.75 Da        Isoelectric Point: 4.5746

>T288654 WP_012577854.1 NZ_LR655210:1401726-1402094 [Bifidobacterium longum subsp. infantis]
MTSTPSEPRLYDVWLMWVEFPDHPGIGKPRPVVITEVDGDLVSGIVAKITGNTDWDEAGDVPLLDWKAEGLLKPSLVRCS
QRFYFNRSELLQWFGRLSLRDAEHVNDGLEATLDIPPYRRSV

Download         Length: 369 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10472.80 Da        Isoelectric Point: 5.0057

>AT288654 WP_012577855.1 NZ_LR655210:1401461-1401745 [Bifidobacterium longum subsp. infantis]
MGKLVANIDDDVKARAAALYDSMGMSLSTAVNMFLRQSLVDNGLPFKPTRHTPDGYPVPPVHNAYMFERSEKGHVILPAD
WNDSEDAVYDQYAK

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB W6EYF0

Antitoxin

Source ID Structure
AlphaFold DB B7GS37

References