Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-couple_hipB |
Location | 1329439..1330090 | Replicon | chromosome |
Accession | NZ_LR595857 | ||
Organism | Streptococcus sp. NCTC 11567 strain NCTC11567 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | FQT67_RS06670 | Protein ID | WP_046177189.1 |
Coordinates | 1329725..1330090 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | FQT67_RS06665 | Protein ID | WP_027971722.1 |
Coordinates | 1329439..1329735 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FQT67_RS06645 | 1324749..1325813 | - | 1065 | WP_046177187.1 | streptolysin associated protein SagC | - |
FQT67_RS06650 | 1325810..1326760 | - | 951 | WP_003061458.1 | SagB family peptide dehydrogenase | - |
FQT67_RS06655 | 1326979..1327140 | - | 162 | WP_012766767.1 | TOMM family cytolysin streptolysin S | - |
FQT67_RS10775 | 1328038..1328205 | - | 168 | WP_165626014.1 | hypothetical protein | - |
FQT67_RS06660 | 1328212..1329417 | - | 1206 | WP_046177188.1 | hypothetical protein | - |
FQT67_RS06665 | 1329439..1329735 | - | 297 | WP_027971722.1 | helix-turn-helix transcriptional regulator | Antitoxin |
FQT67_RS06670 | 1329725..1330090 | - | 366 | WP_046177189.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FQT67_RS06675 | 1330308..1330703 | - | 396 | WP_046177190.1 | hypothetical protein | - |
FQT67_RS06680 | 1330721..1331047 | - | 327 | WP_046177191.1 | hypothetical protein | - |
FQT67_RS06685 | 1331040..1331468 | - | 429 | WP_053042316.1 | hypothetical protein | - |
FQT67_RS06690 | 1331507..1331794 | - | 288 | WP_046177192.1 | hypothetical protein | - |
FQT67_RS06695 | 1331791..1332183 | - | 393 | Protein_1261 | hypothetical protein | - |
FQT67_RS06700 | 1332264..1333408 | + | 1145 | WP_115256952.1 | IS3 family transposase | - |
FQT67_RS06705 | 1333443..1333631 | - | 189 | Protein_1263 | hypothetical protein | - |
FQT67_RS06710 | 1333729..1333911 | - | 183 | WP_000273649.1 | hypothetical protein | - |
FQT67_RS06715 | 1334161..1335045 | - | 885 | WP_053042318.1 | ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | sagA | 1322046..1349112 | 27066 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 14390.55 Da Isoelectric Point: 9.7920
>T288640 WP_046177189.1 NZ_LR595857:c1330090-1329725 [Streptococcus sp. NCTC 11567]
VHNIYFYKDKNGNEPVLDYMRELASKKGKDSRIKLNKINDYIELLSQHGTRAGEPYIKHLDAEIWELRPLRDRILFVAWI
DGSFVLLHHFMKKTQKTPKREIDQAKRELADLKERGLDNEK
VHNIYFYKDKNGNEPVLDYMRELASKKGKDSRIKLNKINDYIELLSQHGTRAGEPYIKHLDAEIWELRPLRDRILFVAWI
DGSFVLLHHFMKKTQKTPKREIDQAKRELADLKERGLDNEK
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|