Detailed information of TA system TA288619

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 66207..66446
• Replicon: plasmid pEcMAD1
• Accession: NZ_LR595692
• Organism: Escherichia coli isolate EcMAD1

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: A0A762TWR7
• Locus tag: ECMAD3_RS23480
• Protein ID: WP_023144756.1
• Coordinates: 66312..66446 (+)
• Length: 45 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	66207..66267 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
ECMAD3_RS23450	61324..63717	+	2394	Protein_72	AAA family ATPase	-
ECMAD3_RS23455	63737..64483	+	747	WP_000205718.1	conjugal transfer pilus acetylase TraX	-
ECMAD3_RS23460	64538..65098	+	561	WP_000139341.1	fertility inhibition protein FinO	-
ECMAD3_RS23465	65229..65441	+	213	WP_013023861.1	hypothetical protein	-
ECMAD3_RS23475	65954..66240	+	287	Protein_76	DUF2726 domain-containing protein	-
-	66207..66267	-	61	NuclAT_0	-	Antitoxin
-	66207..66267	-	61	NuclAT_0	-	Antitoxin
-	66207..66267	-	61	NuclAT_0	-	Antitoxin
-	66207..66267	-	61	NuclAT_0	-	Antitoxin
ECMAD3_RS23480	66312..66446	+	135	WP_023144756.1	type I toxin-antitoxin system Hok family toxin	Toxin
ECMAD3_RS23485	66743..66997	+	255	WP_000083850.1	replication regulatory protein RepA	-
ECMAD3_RS23490	67157..67903	-	747	WP_001016257.1	IS21-like element ISEc12 family helper ATPase IstB	-
ECMAD3_RS23495	67918..69459	-	1542	WP_002431311.1	IS21-like element ISEc12 family transposase	-
ECMAD3_RS24260	69690..69824	+	135	Protein_81	protein CopA/IncA	-
ECMAD3_RS23505	69821..69895	+	75	WP_031943482.1	RepA leader peptide Tap	-
ECMAD3_RS23510	69888..70745	+	858	WP_000130640.1	incFII family plasmid replication initiator RepA	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	mph(A) / aac(3)-IId / blaTEM-1B / aadA5 / qacE / sul1 / tet(B) / aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / sul2 / aph(3'')-Ib / aph(6)-Id	-	1..98473	98473

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (4-44)

Sequences

Toxin

Protein

• Length: 45 a.a.
• Molecular weight: 4896.90 Da
• Isoelectric Point: 7.7209

>T288619 WP_023144756.1 NZ_LR595692:66312-66446 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA

Nucleotide

• Length: 135 bp

Antitoxin

Nucleotide

• Length: 61 bp

>AT288619 NZ_LR595692:c66267-66207 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Structures

Toxin

• AlphaFold DB: A0A762TWR7

Antitoxin