Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 3307463..3308262 | Replicon | chromosome |
Accession | NZ_LR595691 | ||
Organism | Escherichia coli isolate EcMAD1 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | S1NYM6 |
Locus tag | ECMAD3_RS15970 | Protein ID | WP_000347251.1 |
Coordinates | 3307798..3308262 (+) | Length | 155 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | S1EB98 |
Locus tag | ECMAD3_RS15965 | Protein ID | WP_001307405.1 |
Coordinates | 3307463..3307798 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECMAD3_RS15950 | 3303248..3304018 | - | 771 | WP_001058214.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
ECMAD3_RS15955 | 3304034..3305368 | - | 1335 | WP_000599652.1 | galactarate/glucarate/glycerate transporter GarP | - |
ECMAD3_RS15960 | 3305743..3307314 | + | 1572 | WP_001273761.1 | galactarate dehydratase | - |
ECMAD3_RS15965 | 3307463..3307798 | + | 336 | WP_001307405.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
ECMAD3_RS15970 | 3307798..3308262 | + | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
ECMAD3_RS15975 | 3308317..3309126 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
ECMAD3_RS15980 | 3309375..3310655 | + | 1281 | WP_000681903.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
ECMAD3_RS15985 | 3310678..3311151 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
ECMAD3_RS15990 | 3311162..3311941 | + | 780 | WP_000406214.1 | PTS mannose/fructose/sorbose/N-acetylgalactosamine transporter subunit IIC | - |
ECMAD3_RS15995 | 3311931..3312809 | + | 879 | WP_001295548.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
ECMAD3_RS16000 | 3312827..3313261 | + | 435 | WP_000948824.1 | PTS sugar transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3296588..3308262 | 11674 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T288612 WP_000347251.1 NZ_LR595691:3307798-3308262 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJ20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XVC7 |