Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 3194030..3194723 | Replicon | chromosome |
Accession | NZ_LR595691 | ||
Organism | Escherichia coli isolate EcMAD1 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | U9ZN09 |
Locus tag | ECMAD3_RS15435 | Protein ID | WP_000415585.1 |
Coordinates | 3194427..3194723 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | ECMAD3_RS15430 | Protein ID | WP_000650107.1 |
Coordinates | 3194030..3194425 (-) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECMAD3_RS15420 | 3189894..3192152 | - | 2259 | WP_001281841.1 | DNA topoisomerase IV subunit A | - |
ECMAD3_RS15425 | 3192290..3193897 | - | 1608 | WP_001375094.1 | ABC transporter substrate-binding protein | - |
ECMAD3_RS15430 | 3194030..3194425 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
ECMAD3_RS15435 | 3194427..3194723 | - | 297 | WP_000415585.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
ECMAD3_RS15440 | 3194928..3195410 | - | 483 | WP_000183505.1 | transcriptional regulator | - |
ECMAD3_RS15445 | 3195463..3195855 | - | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
ECMAD3_RS15450 | 3196007..3196666 | + | 660 | WP_001221502.1 | two-component system response regulator QseB | - |
ECMAD3_RS15455 | 3196663..3198012 | + | 1350 | WP_000673358.1 | two-component system sensor histidine kinase QseC | - |
ECMAD3_RS15460 | 3198058..3198390 | - | 333 | WP_000914690.1 | DUF2645 family protein | - |
ECMAD3_RS15465 | 3198397..3199589 | - | 1193 | Protein_2984 | Hcp family type VI secretion system effector | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11261.99 Da Isoelectric Point: 8.9070
>T288611 WP_000415585.1 NZ_LR595691:c3194723-3194427 [Escherichia coli]
MEKRTPHTRLSQVKKLVNTGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNTGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT288611 WP_000650107.1 NZ_LR595691:c3194425-3194030 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|