Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 2852036..2852763 | Replicon | chromosome |
| Accession | NZ_LR595691 | ||
| Organism | Escherichia coli isolate EcMAD1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | J7Q991 |
| Locus tag | ECMAD3_RS13750 | Protein ID | WP_000547564.1 |
| Coordinates | 2852452..2852763 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | ECMAD3_RS13745 | Protein ID | WP_000126294.1 |
| Coordinates | 2852036..2852455 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECMAD3_RS13725 | 2847086..2847613 | - | 528 | WP_001078777.1 | electron transport protein HydN | - |
| ECMAD3_RS13730 | 2847762..2848772 | - | 1011 | WP_001392554.1 | DNA-binding transcriptional regulator AscG | - |
| ECMAD3_RS13735 | 2849032..2850489 | + | 1458 | WP_001107861.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| ECMAD3_RS13740 | 2850498..2851922 | + | 1425 | WP_000110363.1 | 6-phospho-beta-glucosidase AscB | - |
| ECMAD3_RS13745 | 2852036..2852455 | - | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
| ECMAD3_RS13750 | 2852452..2852763 | - | 312 | WP_000547564.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| ECMAD3_RS13755 | 2852937..2853698 | - | 762 | WP_001026446.1 | hypothetical protein | - |
| ECMAD3_RS13760 | 2853723..2854193 | - | 471 | WP_060621146.1 | hydrogenase maturation peptidase HycI | - |
| ECMAD3_RS13765 | 2854186..2854596 | - | 411 | WP_001291921.1 | formate hydrogenlyase assembly protein HycH | - |
| ECMAD3_RS13770 | 2854593..2855360 | - | 768 | WP_000067399.1 | formate hydrogenlyase subunit HycG | - |
| ECMAD3_RS13775 | 2855360..2855902 | - | 543 | WP_000493792.1 | formate hydrogenlyase subunit HycF | - |
| ECMAD3_RS13780 | 2855912..2857621 | - | 1710 | WP_001288134.1 | formate hydrogenlyase subunit HycE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12426.13 Da Isoelectric Point: 9.7248
>T288608 WP_000547564.1 NZ_LR595691:c2852763-2852452 [Escherichia coli]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFRYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT288608 WP_000126294.1 NZ_LR595691:c2852455-2852036 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|