Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 114237..115012 | Replicon | chromosome |
| Accession | NZ_LR594689 | ||
| Organism | Variovorax sp. WDL1 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | V6ADY6 |
| Locus tag | E5P1_RS00645 | Protein ID | WP_009518525.1 |
| Coordinates | 114237..114695 (-) | Length | 153 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | V6AEP7 |
| Locus tag | E5P1_RS00650 | Protein ID | WP_023098543.1 |
| Coordinates | 114695..115012 (-) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E5P1_RS00620 | 109578..110525 | + | 948 | WP_009518520.1 | TIGR03756 family integrating conjugative element protein | - |
| E5P1_RS00625 | 110535..111929 | + | 1395 | WP_102905818.1 | integrating conjugative element protein | - |
| E5P1_RS00630 | 111926..112285 | + | 360 | WP_009518522.1 | hypothetical protein | - |
| E5P1_RS00635 | 112300..113817 | + | 1518 | WP_009518523.1 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
| E5P1_RS00640 | 113833..114210 | - | 378 | WP_009518524.1 | DUF3742 family protein | - |
| E5P1_RS00645 | 114237..114695 | - | 459 | WP_009518525.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
| E5P1_RS00650 | 114695..115012 | - | 318 | WP_023098543.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
| E5P1_RS00655 | 115312..117126 | + | 1815 | WP_068681684.1 | TraI domain-containing protein | - |
| E5P1_RS00660 | 117226..117939 | + | 714 | WP_068673446.1 | UPF0149 family protein | - |
| E5P1_RS00665 | 117970..119535 | - | 1566 | WP_102905039.1 | IS66 family transposase | - |
| E5P1_RS00670 | 119630..119983 | - | 354 | WP_068673444.1 | IS66 family insertion sequence element accessory protein TnpB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 153 a.a. Molecular weight: 17660.02 Da Isoelectric Point: 10.1848
>T288585 WP_009518525.1 NZ_LR594689:c114695-114237 [Variovorax sp. WDL1]
MQRHGWTLLFHDCVIEQLQKLHAAARRAQENDPAGFESNANVKLFRALSQLMLDVVPGDPARDEYRQGNTLGPAHRHWRR
AKIGRRFRLFFRYDSKAKVIVYAWVNDEQTLRSSGSKSDPYVVFEKMLGRGNPPDDWHALIQASKQDWSKLE
MQRHGWTLLFHDCVIEQLQKLHAAARRAQENDPAGFESNANVKLFRALSQLMLDVVPGDPARDEYRQGNTLGPAHRHWRR
AKIGRRFRLFFRYDSKAKVIVYAWVNDEQTLRSSGSKSDPYVVFEKMLGRGNPPDDWHALIQASKQDWSKLE
Download Length: 459 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|