Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2680251..2680514 | Replicon | chromosome |
Accession | NZ_LR594051 | ||
Organism | Enterococcus faecalis strain NCTC8732 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | S4BYM2 |
Locus tag | FGL29_RS13955 | Protein ID | WP_002392696.1 |
Coordinates | 2680371..2680514 (-) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2680251..2680438 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGL29_RS13940 | 2675617..2676330 | - | 714 | WP_002381063.1 | trehalose operon repressor | - |
FGL29_RS13945 | 2676592..2679336 | + | 2745 | WP_002398920.1 | glycoside hydrolase family 65 protein | - |
FGL29_RS13950 | 2679351..2680001 | + | 651 | WP_002354875.1 | beta-phosphoglucomutase | - |
- | 2680251..2680438 | + | 188 | - | - | Antitoxin |
FGL29_RS13955 | 2680371..2680514 | - | 144 | WP_002392696.1 | putative holin-like toxin | Toxin |
FGL29_RS13960 | 2681331..2681863 | + | 533 | Protein_2589 | CPBP family intramembrane metalloprotease | - |
FGL29_RS13965 | 2681917..2682888 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
FGL29_RS13970 | 2683063..2683500 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
FGL29_RS13975 | 2683633..2684187 | - | 555 | WP_002354869.1 | septum formation protein Maf | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5297.43 Da Isoelectric Point: 10.6867
>T288545 WP_002392696.1 NZ_LR594051:c2680514-2680371 [Enterococcus faecalis]
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 144 bp
Antitoxin
Download Length: 188 bp
>AT288545 NZ_LR594051:2680251-2680438 [Enterococcus faecalis]
TGTGCTATAATGAAAATGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACTTTTT
GAATTATTTAAAAATAACCGTACTCGGTCAAAGTTGACGGTTATTTTTTATTGTCATTTTTAAGCAATTTCACAATCAGT
GCAATCAAAGCAATGGTAAACATACCAA
TGTGCTATAATGAAAATGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACTTTTT
GAATTATTTAAAAATAACCGTACTCGGTCAAAGTTGACGGTTATTTTTTATTGTCATTTTTAAGCAATTTCACAATCAGT
GCAATCAAAGCAATGGTAAACATACCAA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|