Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/YoeB-RelB
Location 284461..284974 Replicon chromosome
Accession NZ_LR594047
Organism Streptococcus dysgalactiae subsp. equisimilis strain NCTC11554

Toxin (Protein)


Gene name yoeB Uniprot ID -
Locus tag FGL21_RS01590 Protein ID WP_003053779.1
Coordinates 284461..284715 (-) Length 85 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID -
Locus tag FGL21_RS01595 Protein ID WP_003053797.1
Coordinates 284708..284974 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FGL21_RS01560 280703..281113 - 411 WP_003053802.1 conjugal transfer protein -
FGL21_RS01565 281116..281340 - 225 WP_003053785.1 hypothetical protein -
FGL21_RS01570 281344..282354 - 1011 WP_003053776.1 conjugal transfer protein -
FGL21_RS01575 282366..282902 - 537 WP_003053800.1 hypothetical protein -
FGL21_RS01580 282929..283159 - 231 WP_003053793.1 hypothetical protein -
FGL21_RS01585 283179..284405 - 1227 WP_003053775.1 replication initiation factor domain-containing protein -
FGL21_RS01590 284461..284715 - 255 WP_003053779.1 Txe/YoeB family addiction module toxin Toxin
FGL21_RS01595 284708..284974 - 267 WP_003053797.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
FGL21_RS01600 285239..286924 - 1686 WP_014611999.1 cell division protein FtsK -
FGL21_RS01605 286941..287402 - 462 WP_003056467.1 hypothetical protein -
FGL21_RS01610 287421..287717 - 297 WP_138127951.1 cytoplasmic protein -
FGL21_RS01615 287757..288002 - 246 WP_003056472.1 hypothetical protein -
FGL21_RS01620 288575..288916 + 342 WP_111711548.1 helix-turn-helix domain-containing protein -
FGL21_RS01625 289120..289425 + 306 WP_014612001.1 hypothetical protein -
FGL21_RS01630 289460..289819 - 360 WP_003053656.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 255992..299025 43033


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(2-83)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 10501.83 Da        Isoelectric Point: 8.4060

>T288535 WP_003053779.1 NZ_LR594047:c284715-284461 [Streptococcus dysgalactiae subsp. equisimilis]
MFNFTEEAWEDYTSWQREDKKILKRINRLIEDIKRHPFEGIGKPEPLKYRYSGAWSRRITDEHRLVYTVEQNDIYFLSFR
DHYK

Download         Length: 255 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10402.81 Da        Isoelectric Point: 4.5216

>AT288535 WP_003053797.1 NZ_LR594047:c284974-284708 [Streptococcus dysgalactiae subsp. equisimilis]
MEAVVYSNFRNNLKDYMKKVNDEYEPLMVVNKNPEENIVVLSKDNWDSIQETIRIMNNEYLSDKVLSGLEQVKQKKVTQH
QLLEVEDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References