Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/YoeB-RelB |
Location | 284461..284974 | Replicon | chromosome |
Accession | NZ_LR594047 | ||
Organism | Streptococcus dysgalactiae subsp. equisimilis strain NCTC11554 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | - |
Locus tag | FGL21_RS01590 | Protein ID | WP_003053779.1 |
Coordinates | 284461..284715 (-) | Length | 85 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | FGL21_RS01595 | Protein ID | WP_003053797.1 |
Coordinates | 284708..284974 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGL21_RS01560 | 280703..281113 | - | 411 | WP_003053802.1 | conjugal transfer protein | - |
FGL21_RS01565 | 281116..281340 | - | 225 | WP_003053785.1 | hypothetical protein | - |
FGL21_RS01570 | 281344..282354 | - | 1011 | WP_003053776.1 | conjugal transfer protein | - |
FGL21_RS01575 | 282366..282902 | - | 537 | WP_003053800.1 | hypothetical protein | - |
FGL21_RS01580 | 282929..283159 | - | 231 | WP_003053793.1 | hypothetical protein | - |
FGL21_RS01585 | 283179..284405 | - | 1227 | WP_003053775.1 | replication initiation factor domain-containing protein | - |
FGL21_RS01590 | 284461..284715 | - | 255 | WP_003053779.1 | Txe/YoeB family addiction module toxin | Toxin |
FGL21_RS01595 | 284708..284974 | - | 267 | WP_003053797.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
FGL21_RS01600 | 285239..286924 | - | 1686 | WP_014611999.1 | cell division protein FtsK | - |
FGL21_RS01605 | 286941..287402 | - | 462 | WP_003056467.1 | hypothetical protein | - |
FGL21_RS01610 | 287421..287717 | - | 297 | WP_138127951.1 | cytoplasmic protein | - |
FGL21_RS01615 | 287757..288002 | - | 246 | WP_003056472.1 | hypothetical protein | - |
FGL21_RS01620 | 288575..288916 | + | 342 | WP_111711548.1 | helix-turn-helix domain-containing protein | - |
FGL21_RS01625 | 289120..289425 | + | 306 | WP_014612001.1 | hypothetical protein | - |
FGL21_RS01630 | 289460..289819 | - | 360 | WP_003053656.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 255992..299025 | 43033 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 85 a.a. Molecular weight: 10501.83 Da Isoelectric Point: 8.4060
>T288535 WP_003053779.1 NZ_LR594047:c284715-284461 [Streptococcus dysgalactiae subsp. equisimilis]
MFNFTEEAWEDYTSWQREDKKILKRINRLIEDIKRHPFEGIGKPEPLKYRYSGAWSRRITDEHRLVYTVEQNDIYFLSFR
DHYK
MFNFTEEAWEDYTSWQREDKKILKRINRLIEDIKRHPFEGIGKPEPLKYRYSGAWSRRITDEHRLVYTVEQNDIYFLSFR
DHYK
Download Length: 255 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|