Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 1951203..1951863 | Replicon | chromosome |
Accession | NZ_LR594038 | ||
Organism | Klebsiella grimontii strain NCTC9146 substr. serovar casular |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | FGL39_RS09305 | Protein ID | WP_049089248.1 |
Coordinates | 1951203..1951556 (+) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A9E1DQ94 |
Locus tag | FGL39_RS09310 | Protein ID | WP_004132739.1 |
Coordinates | 1951561..1951863 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGL39_RS09280 | 1946587..1947354 | - | 768 | WP_004132727.1 | molybdopterin-dependent oxidoreductase | - |
FGL39_RS09285 | 1947344..1947952 | - | 609 | WP_004132729.1 | cytochrome b/b6 domain-containing protein | - |
FGL39_RS09290 | 1947967..1948593 | - | 627 | WP_004132731.1 | hypothetical protein | - |
FGL39_RS09295 | 1948733..1949401 | + | 669 | WP_004132733.1 | heavy metal response regulator transcription factor | - |
FGL39_RS09300 | 1949401..1950819 | + | 1419 | WP_049085817.1 | heavy metal sensor histidine kinase | - |
FGL39_RS09305 | 1951203..1951556 | + | 354 | WP_049089248.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FGL39_RS09310 | 1951561..1951863 | + | 303 | WP_004132739.1 | XRE family transcriptional regulator | Antitoxin |
FGL39_RS09315 | 1951954..1952127 | + | 174 | WP_101868488.1 | helix-turn-helix domain-containing protein | - |
FGL39_RS09320 | 1952250..1952453 | + | 204 | Protein_1807 | hypothetical protein | - |
FGL39_RS09325 | 1952454..1952787 | + | 334 | Protein_1808 | type II toxin-antitoxin system PemK/MazF family toxin | - |
FGL39_RS09330 | 1953126..1953263 | + | 138 | Protein_1809 | patatin | - |
FGL39_RS09335 | 1953404..1954285 | - | 882 | WP_064793685.1 | hypothetical protein | - |
FGL39_RS09340 | 1954694..1954942 | + | 249 | WP_138110103.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13639.64 Da Isoelectric Point: 9.8874
>T288516 WP_049089248.1 NZ_LR594038:1951203-1951556 [Klebsiella grimontii]
VWMIKTTDTFERWFTSLNDTDRARVLAALLVLREKGPGLSRPYADTLRGSRYSDMKELRIQSRGEPIRAFFAFDPARTGI
VLCAGNKVGNEKRFYDEMLPVAEREFTNWLKTFKEKE
VWMIKTTDTFERWFTSLNDTDRARVLAALLVLREKGPGLSRPYADTLRGSRYSDMKELRIQSRGEPIRAFFAFDPARTGI
VLCAGNKVGNEKRFYDEMLPVAEREFTNWLKTFKEKE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|