Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-couple_hipB |
Location | 1279445..1280096 | Replicon | chromosome |
Accession | NZ_LR594037 | ||
Organism | Streptococcus anginosus strain NCTC11064 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A0P0NA83 |
Locus tag | FGK97_RS06335 | Protein ID | WP_003023734.1 |
Coordinates | 1279731..1280096 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A0P0NA18 |
Locus tag | FGK97_RS06330 | Protein ID | WP_003023736.1 |
Coordinates | 1279445..1279741 (-) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGK97_RS06315 | 1275014..1275610 | - | 597 | WP_021001926.1 | recombination mediator RecR | - |
FGK97_RS06320 | 1275621..1277681 | - | 2061 | WP_021001927.1 | penicillin-binding protein PBP2B | - |
FGK97_RS09680 | 1278044..1278211 | - | 168 | WP_003023739.1 | hypothetical protein | - |
FGK97_RS06325 | 1278218..1279423 | - | 1206 | WP_003023737.1 | hypothetical protein | - |
FGK97_RS06330 | 1279445..1279741 | - | 297 | WP_003023736.1 | helix-turn-helix transcriptional regulator | Antitoxin |
FGK97_RS06335 | 1279731..1280096 | - | 366 | WP_003023734.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FGK97_RS06340 | 1280371..1280550 | - | 180 | WP_106079412.1 | hypothetical protein | - |
FGK97_RS06345 | 1280888..1281415 | + | 528 | Protein_1208 | site-specific integrase | - |
FGK97_RS06350 | 1281573..1282265 | - | 693 | WP_003023729.1 | phosphoglycerate mutase | - |
FGK97_RS06355 | 1282407..1282868 | - | 462 | WP_003031404.1 | transcriptional repressor | - |
FGK97_RS06360 | 1283045..1283320 | - | 276 | WP_003023726.1 | HU family DNA-binding protein | - |
FGK97_RS06365 | 1283449..1284282 | - | 834 | WP_003023725.1 | DegV family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 14583.84 Da Isoelectric Point: 10.1543
>T288512 WP_003023734.1 NZ_LR594037:c1280096-1279731 [Streptococcus anginosus]
VHNIYFYKDKNGNEPVLDYMRELASKKGKDSRIKLNKINDYIELLSQRGTRAGEPYIKHLDAEIWELRPLRDRILFVAWI
DGNFVLLHHFMKKTQKTPKREIEQAKRELRDLKERGLYNEK
VHNIYFYKDKNGNEPVLDYMRELASKKGKDSRIKLNKINDYIELLSQRGTRAGEPYIKHLDAEIWELRPLRDRILFVAWI
DGNFVLLHHFMKKTQKTPKREIEQAKRELRDLKERGLYNEK
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0P0NA83 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0P0NA18 |