Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 4560167..4560771 | Replicon | chromosome |
Accession | NZ_LR590482 | ||
Organism | Pseudomonas synxantha strain NCTC10696 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | FGL41_RS21100 | Protein ID | WP_057022036.1 |
Coordinates | 4560167..4560481 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | FGL41_RS21105 | Protein ID | WP_057022035.1 |
Coordinates | 4560484..4560771 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGL41_RS21080 | 4555230..4556267 | - | 1038 | WP_057022040.1 | histone deacetylase family protein | - |
FGL41_RS21085 | 4556402..4557634 | - | 1233 | WP_057022039.1 | Zn-dependent hydrolase | - |
FGL41_RS21090 | 4557646..4558962 | - | 1317 | WP_057022038.1 | MHS family MFS transporter | - |
FGL41_RS21095 | 4559120..4560061 | + | 942 | WP_057022037.1 | LysR family transcriptional regulator | - |
FGL41_RS21100 | 4560167..4560481 | + | 315 | WP_057022036.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FGL41_RS21105 | 4560484..4560771 | + | 288 | WP_057022035.1 | helix-turn-helix domain-containing protein | Antitoxin |
FGL41_RS21110 | 4561011..4562237 | + | 1227 | WP_057022034.1 | MFS transporter | - |
FGL41_RS21115 | 4562312..4562566 | - | 255 | WP_057022033.1 | hypothetical protein | - |
FGL41_RS21125 | 4563220..4563459 | + | 240 | WP_014717442.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
FGL41_RS21130 | 4563449..4563742 | + | 294 | WP_057022032.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
FGL41_RS21140 | 4564011..4564724 | - | 714 | WP_057022031.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
FGL41_RS21145 | 4564752..4565510 | - | 759 | WP_056847351.1 | MBL fold metallo-hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11656.44 Da Isoelectric Point: 9.8054
>T288495 WP_057022036.1 NZ_LR590482:4560167-4560481 [Pseudomonas synxantha]
MIFIETSVFTRRVKELIDEDAYTALQNVLVVNPSAGDVIEGTGGVRKIRVAAKGHGKRGGARVIYYHFVSASQIVLLMIY
PKNEQQDLTADERKSLKAAIEHWR
MIFIETSVFTRRVKELIDEDAYTALQNVLVVNPSAGDVIEGTGGVRKIRVAAKGHGKRGGARVIYYHFVSASQIVLLMIY
PKNEQQDLTADERKSLKAAIEHWR
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|