Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 2193270..2193924 | Replicon | chromosome |
Accession | NZ_LR590482 | ||
Organism | Pseudomonas synxantha strain NCTC10696 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A0R2YXS2 |
Locus tag | FGL41_RS10250 | Protein ID | WP_057024311.1 |
Coordinates | 2193574..2193924 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A0W0N117 |
Locus tag | FGL41_RS10245 | Protein ID | WP_014718915.1 |
Coordinates | 2193270..2193584 (-) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGL41_RS10210 | 2188940..2190070 | + | 1131 | WP_057024307.1 | MFS transporter | - |
FGL41_RS10215 | 2190078..2190599 | - | 522 | WP_057024308.1 | DUF3087 domain-containing protein | - |
FGL41_RS10220 | 2190714..2190893 | + | 180 | WP_046068648.1 | hypothetical protein | - |
FGL41_RS10225 | 2190906..2191112 | + | 207 | WP_046068647.1 | hypothetical protein | - |
FGL41_RS10230 | 2191143..2191379 | - | 237 | WP_005789137.1 | hypothetical protein | - |
FGL41_RS10235 | 2191498..2192331 | + | 834 | WP_057024309.1 | arylamine N-acetyltransferase | - |
FGL41_RS10240 | 2192457..2193209 | + | 753 | WP_057024310.1 | outer membrane beta-barrel protein | - |
FGL41_RS10245 | 2193270..2193584 | - | 315 | WP_014718915.1 | XRE family transcriptional regulator | Antitoxin |
FGL41_RS10250 | 2193574..2193924 | - | 351 | WP_057024311.1 | hypothetical protein | Toxin |
FGL41_RS10255 | 2194162..2195625 | - | 1464 | WP_003192122.1 | NADH-quinone oxidoreductase subunit NuoN | - |
FGL41_RS10260 | 2195633..2197165 | - | 1533 | WP_057024312.1 | NADH-quinone oxidoreductase subunit M | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13758.68 Da Isoelectric Point: 9.7334
>T288492 WP_057024311.1 NZ_LR590482:c2193924-2193574 [Pseudomonas synxantha]
MDALFIELPAFERHRKDYLSDELFQGFQQELMKTPEAGDVIEGTGGLRKVRFVDERRNKGKRGGLRVIYYWWSGGTQFWL
FTLYGKHEQSDLTPHHKKALKHMLDREIKARTHHET
MDALFIELPAFERHRKDYLSDELFQGFQQELMKTPEAGDVIEGTGGLRKVRFVDERRNKGKRGGLRVIYYWWSGGTQFWL
FTLYGKHEQSDLTPHHKKALKHMLDREIKARTHHET
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0R2YXS2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0W0N117 |