Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) DinJ-YafQ (relBE)/YafQ-RelB
Location 1319293..1319838 Replicon chromosome
Accession NZ_LR590469
Organism Yersinia enterocolitica subsp. enterocolitica strain NCTC12982

Toxin (Protein)


Gene name yafQ Uniprot ID A0A8B6KSX9
Locus tag FGL26_RS06285 Protein ID WP_005170383.1
Coordinates 1319293..1319571 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID A0A8B6KT24
Locus tag FGL26_RS06290 Protein ID WP_005170385.1
Coordinates 1319578..1319838 (-) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FGL26_RS06250 1314767..1315222 + 456 WP_005170367.1 phage tail protein -
FGL26_RS06255 1315219..1315677 + 459 WP_005170370.1 phage virion morphogenesis protein -
FGL26_RS06260 1315721..1316761 - 1041 WP_005170374.1 hypothetical protein -
FGL26_RS06265 1316758..1318011 - 1254 WP_005170376.1 hypothetical protein -
FGL26_RS06270 1318192..1318821 + 630 WP_005170378.1 phage baseplate assembly protein V -
FGL26_RS06275 1318959..1319159 + 201 Protein_1186 Rpn family recombination-promoting nuclease/putative transposase -
FGL26_RS06280 1319173..1319250 + 78 Protein_1187 tail fiber assembly protein -
FGL26_RS06285 1319293..1319571 - 279 WP_005170383.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
FGL26_RS06290 1319578..1319838 - 261 WP_005170385.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
FGL26_RS06295 1319910..1320077 - 168 WP_005170387.1 hypothetical protein -
FGL26_RS06300 1320219..1320425 + 207 WP_005170388.1 host cell division inhibitor Icd-like protein -
FGL26_RS06305 1320415..1320735 + 321 WP_005170392.1 hypothetical protein -
FGL26_RS06310 1320852..1320995 - 144 Protein_1193 XRE family transcriptional regulator -
FGL26_RS06315 1321220..1321570 + 351 WP_005170397.1 GPW/gp25 family protein -
FGL26_RS06320 1321575..1322483 + 909 WP_005170400.1 baseplate assembly protein -
FGL26_RS06325 1322476..1323018 + 543 WP_005170403.1 phage tail protein I -
FGL26_RS06330 1323269..1324397 + 1129 Protein_1197 phage tail protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - pilW / pilW 1286973..1339090 52117


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(4-92)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(4-84)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 11033.77 Da        Isoelectric Point: 9.8470

>T288472 WP_005170383.1 NZ_LR590469:c1319571-1319293 [Yersinia enterocolitica subsp. enterocolitica]
MTKQREIEYSGQFQKDVKKAQKRHKDMNKLKVIMTLLINDKLPLPVVYKDHQLQGNYKGYRDAHIEPDWLIIYKITDDLL
RFERTGSHSDLF

Download         Length: 279 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9307.69 Da        Isoelectric Point: 5.0758

>AT288472 WP_005170385.1 NZ_LR590469:c1319838-1319578 [Yersinia enterocolitica subsp. enterocolitica]
MAANAFVRARIDETLKNEAAAVLADMGLTVSDLVRITLTKVAREKALPFDLRIPNELTANTIANSDKGVDVHKAKDADDL
FDKLGI

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A8B6KSX9

Antitoxin

Source ID Structure
AlphaFold DB A0A8B6KT24

References