Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 3005605..3006260 | Replicon | chromosome |
Accession | NZ_LR590467 | ||
Organism | Bordetella pertussis strain NCTC13251 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | - |
Locus tag | FGL36_RS14695 | Protein ID | WP_047122780.1 |
Coordinates | 3006009..3006260 (-) | Length | 84 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | Q7VY40 |
Locus tag | FGL36_RS14690 | Protein ID | WP_003809516.1 |
Coordinates | 3005605..3006006 (-) | Length | 134 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGL36_RS14660 | 3000788..3001810 | - | 1023 | WP_003809532.1 | amino acid ABC transporter substrate-binding protein | - |
FGL36_RS14665 | 3001947..3002984 | - | 1038 | WP_023853543.1 | threonylcarbamoyl-AMP synthase | - |
FGL36_RS14670 | 3003004..3004194 | - | 1191 | WP_010930406.1 | 5-(carboxyamino)imidazole ribonucleotide synthase | - |
FGL36_RS14675 | 3004197..3004712 | - | 516 | WP_019247930.1 | 5-(carboxyamino)imidazole ribonucleotide mutase | - |
FGL36_RS14680 | 3004862..3005341 | - | 480 | WP_010930405.1 | disulfide bond formation protein B | - |
FGL36_RS14685 | 3005349..3005585 | - | 237 | WP_010930404.1 | membrane protein | - |
FGL36_RS14690 | 3005605..3006006 | - | 402 | WP_003809516.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
FGL36_RS14695 | 3006009..3006260 | - | 252 | WP_047122780.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
FGL36_RS14700 | 3006315..3007196 | - | 882 | WP_003809513.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
FGL36_RS14705 | 3007421..3007867 | + | 447 | WP_003819827.1 | GFA family protein | - |
FGL36_RS14710 | 3007952..3009016 | - | 1065 | WP_003809510.1 | fructose-bisphosphate aldolase class II | - |
FGL36_RS14715 | 3009153..3009734 | - | 582 | WP_019247931.1 | molybdenum cofactor biosysynthesis protein | - |
FGL36_RS14720 | 3009969..3011099 | + | 1131 | WP_010930401.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 84 a.a. Molecular weight: 8952.52 Da Isoelectric Point: 9.7242
>T288469 WP_047122780.1 NZ_LR590467:c3006260-3006009 [Bordetella pertussis]
IGGAATKKPGQKRRAGAAALGLDFSAMVEIVLALTPRDFHKSMTTHADHRIWQDVYCPVTAMGAVYLKLTVLDGVPIVSF
KEL
IGGAATKKPGQKRRAGAAALGLDFSAMVEIVLALTPRDFHKSMTTHADHRIWQDVYCPVTAMGAVYLKLTVLDGVPIVSF
KEL
Download Length: 252 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14528.70 Da Isoelectric Point: 8.5005
>AT288469 WP_003809516.1 NZ_LR590467:c3006006-3005605 [Bordetella pertussis]
MKCPVCGAAALARDTRDVPYSYKGETITIAAVTGDWCPACGENVLDGAESARVSEAMLAFNRLVNARRVDPGFIVRVRRK
LGLDQREAAALFGGGTNAFSRYENGKTRPPLALVKLLRLLDRHPELLEEVRAD
MKCPVCGAAALARDTRDVPYSYKGETITIAAVTGDWCPACGENVLDGAESARVSEAMLAFNRLVNARRVDPGFIVRVRRK
LGLDQREAAALFGGGTNAFSRYENGKTRPPLALVKLLRLLDRHPELLEEVRAD
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|