Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 355076..355722 | Replicon | chromosome |
| Accession | NZ_LR588412 | ||
| Organism | Klebsiella pneumoniae strain NCTC9157 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | W9BBY1 |
| Locus tag | FGL27_RS01650 | Protein ID | WP_016529833.1 |
| Coordinates | 355076..355423 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A1F2LZT5 |
| Locus tag | FGL27_RS01655 | Protein ID | WP_008806992.1 |
| Coordinates | 355423..355722 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FGL27_RS01640 | 351002..352435 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
| FGL27_RS01645 | 352453..354900 | + | 2448 | WP_087759684.1 | glycogen phosphorylase | - |
| FGL27_RS01650 | 355076..355423 | + | 348 | WP_016529833.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| FGL27_RS01655 | 355423..355722 | + | 300 | WP_008806992.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| FGL27_RS01660 | 355785..357293 | - | 1509 | WP_002920554.1 | glycerol-3-phosphate dehydrogenase | - |
| FGL27_RS01665 | 357498..357827 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
| FGL27_RS01670 | 357878..358708 | + | 831 | WP_004151408.1 | rhomboid family intramembrane serine protease GlpG | - |
| FGL27_RS01675 | 358758..359525 | + | 768 | WP_138074149.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13549.56 Da Isoelectric Point: 5.6749
>T288450 WP_016529833.1 NZ_LR588412:355076-355423 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | W9BBY1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1F2LZT5 |