Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 328888..329474 Replicon chromosome
Accession NZ_LR588412
Organism Klebsiella pneumoniae strain NCTC9157

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag FGL27_RS01540 Protein ID WP_021312828.1
Coordinates 329106..329474 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID -
Locus tag FGL27_RS01535 Protein ID WP_138074146.1
Coordinates 328888..329109 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FGL27_RS01515 325045..325971 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
FGL27_RS01520 325968..327245 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
FGL27_RS01525 327242..328009 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
FGL27_RS01530 328011..328724 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
FGL27_RS01535 328888..329109 + 222 WP_138074146.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
FGL27_RS01540 329106..329474 + 369 WP_021312828.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
FGL27_RS01545 329747..331063 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
FGL27_RS01550 331170..332057 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
FGL27_RS01555 332054..332899 + 846 WP_004185988.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
FGL27_RS01560 332901..333971 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 325968..334708 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13578.96 Da        Isoelectric Point: 8.5493

>T288449 WP_021312828.1 NZ_LR588412:329106-329474 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGYIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.20 Da        Isoelectric Point: 5.0893

>AT288449 WP_138074146.1 NZ_LR588412:328888-329109 [Klebsiella pneumoniae]
MRTVNYSEARKNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References