Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 3799686..3800283 | Replicon | chromosome |
Accession | NZ_LR588408 | ||
Organism | Klebsiella pneumoniae strain NCTC11698 |
Toxin (Protein)
Gene name | higB | Uniprot ID | R4YIC5 |
Locus tag | FGL30_RS18580 | Protein ID | WP_004142563.1 |
Coordinates | 3799966..3800283 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | R4YH91 |
Locus tag | FGL30_RS18575 | Protein ID | WP_004142561.1 |
Coordinates | 3799686..3799973 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGL30_RS18545 | 3795766..3796014 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
FGL30_RS18550 | 3796032..3796373 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
FGL30_RS18555 | 3796404..3797519 | - | 1116 | WP_012737592.1 | MBL fold metallo-hydrolase | - |
FGL30_RS18560 | 3797699..3798280 | + | 582 | WP_004176968.1 | TetR/AcrR family transcriptional regulator | - |
FGL30_RS18565 | 3798280..3798648 | + | 369 | WP_004142557.1 | MmcQ/YjbR family DNA-binding protein | - |
FGL30_RS18570 | 3798768..3799421 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
FGL30_RS18575 | 3799686..3799973 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
FGL30_RS18580 | 3799966..3800283 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
FGL30_RS18585 | 3800468..3801511 | - | 1044 | WP_023284821.1 | DUF2157 domain-containing protein | - |
FGL30_RS18590 | 3802181..3803047 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
FGL30_RS18595 | 3803156..3804583 | + | 1428 | WP_004176980.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T288433 WP_004142563.1 NZ_LR588408:c3800283-3799966 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M5MXH8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3DIQ1 |