Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 3822703..3823382 | Replicon | chromosome |
| Accession | NZ_LR536431 | ||
| Organism | Escherichia coli isolate f9610206-5e81-11e8-bf7f-3c4a9275d6c8 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XN95 |
| Locus tag | E4Z82_RS19220 | Protein ID | WP_000057540.1 |
| Coordinates | 3823080..3823382 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | E4Z82_RS19215 | Protein ID | WP_000806442.1 |
| Coordinates | 3822703..3823044 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E4Z82_RS19205 | 3818947..3819879 | - | 933 | WP_000883012.1 | glutaminase A | - |
| E4Z82_RS19210 | 3820141..3822645 | + | 2505 | WP_000083978.1 | copper-exporting P-type ATPase CopA | - |
| E4Z82_RS19215 | 3822703..3823044 | - | 342 | WP_000806442.1 | HigA family addiction module antidote protein | Antitoxin |
| E4Z82_RS19220 | 3823080..3823382 | - | 303 | WP_000057540.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| E4Z82_RS19225 | 3823515..3824309 | + | 795 | WP_000365175.1 | TraB/GumN family protein | - |
| E4Z82_RS19230 | 3824513..3824992 | + | 480 | WP_000186631.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| E4Z82_RS19235 | 3825029..3826681 | - | 1653 | WP_000771738.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
| E4Z82_RS19240 | 3826899..3828119 | + | 1221 | WP_001251608.1 | fosmidomycin MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11781.35 Da Isoelectric Point: 10.2638
>T288415 WP_000057540.1 NZ_LR536431:c3823382-3823080 [Escherichia coli]
MAQKNNIRSFRDAWLADFFVHSTPHRKIPAEIHTSLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKNNIRSFRDAWLADFFVHSTPHRKIPAEIHTSLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|