Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1172435..1173192 | Replicon | chromosome |
Accession | NZ_LR536431 | ||
Organism | Escherichia coli isolate f9610206-5e81-11e8-bf7f-3c4a9275d6c8 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A377MUG9 |
Locus tag | E4Z82_RS05790 | Protein ID | WP_000266200.1 |
Coordinates | 1172435..1172776 (+) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | E4Z82_RS05795 | Protein ID | WP_000126296.1 |
Coordinates | 1172773..1173192 (+) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E4Z82_RS05760 | 1167618..1169327 | + | 1710 | WP_001288134.1 | formate hydrogenlyase subunit HycE | - |
E4Z82_RS05765 | 1169337..1169879 | + | 543 | WP_000493763.1 | formate hydrogenlyase subunit HycF | - |
E4Z82_RS05770 | 1169879..1170646 | + | 768 | WP_000067392.1 | formate hydrogenlyase subunit HycG | - |
E4Z82_RS05775 | 1170643..1171053 | + | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
E4Z82_RS05780 | 1171046..1171516 | + | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
E4Z82_RS05785 | 1171541..1172314 | + | 774 | WP_001026444.1 | hypothetical protein | - |
E4Z82_RS05790 | 1172435..1172776 | + | 342 | WP_000266200.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
E4Z82_RS05795 | 1172773..1173192 | + | 420 | WP_000126296.1 | helix-turn-helix domain-containing protein | Antitoxin |
E4Z82_RS05800 | 1173306..1174730 | - | 1425 | WP_000110319.1 | 6-phospho-beta-glucosidase AscB | - |
E4Z82_RS05805 | 1174739..1176196 | - | 1458 | WP_001107847.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
E4Z82_RS05810 | 1176456..1177466 | + | 1011 | WP_001402444.1 | DNA-binding transcriptional regulator AscG | - |
E4Z82_RS05815 | 1177615..1178142 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13733.68 Da Isoelectric Point: 9.7506
>T288408 WP_000266200.1 NZ_LR536431:1172435-1172776 [Escherichia coli]
MWLFTYYKEVKNIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVI
AYINFVNKRFFVKHITNHAEYDKLTRYYRENKE
MWLFTYYKEVKNIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVI
AYINFVNKRFFVKHITNHAEYDKLTRYYRENKE
Download Length: 342 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.38 Da Isoelectric Point: 4.3653
>AT288408 WP_000126296.1 NZ_LR536431:1172773-1173192 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNQEFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNQEFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|