Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 730918..731645 | Replicon | chromosome |
Accession | NZ_LR536431 | ||
Organism | Escherichia coli isolate f9610206-5e81-11e8-bf7f-3c4a9275d6c8 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | E4Z82_RS03630 | Protein ID | WP_000550189.1 |
Coordinates | 730918..731232 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | E4Z82_RS03635 | Protein ID | WP_000560263.1 |
Coordinates | 731229..731645 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E4Z82_RS03610 | 727084..728070 | - | 987 | WP_001446103.1 | Gfo/Idh/MocA family oxidoreductase | - |
E4Z82_RS03615 | 728149..728832 | - | 684 | WP_001183037.1 | vancomycin high temperature exclusion protein | - |
E4Z82_RS03620 | 728909..729412 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
E4Z82_RS03625 | 729497..730633 | + | 1137 | WP_000018685.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
E4Z82_RS03630 | 730918..731232 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
E4Z82_RS03635 | 731229..731645 | + | 417 | WP_000560263.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
E4Z82_RS03640 | 731690..733708 | - | 2019 | WP_000121448.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
E4Z82_RS03645 | 734134..736485 | - | 2352 | WP_032175665.1 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T288405 WP_000550189.1 NZ_LR536431:730918-731232 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14979.42 Da Isoelectric Point: 4.4547
>AT288405 WP_000560263.1 NZ_LR536431:731229-731645 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLADLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLADLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|