Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1827108..1827835 | Replicon | chromosome |
Accession | NZ_LR536430 | ||
Organism | Escherichia coli isolate f974b26a-5e81-11e8-bf7f-3c4a9275d6c8 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | E4Z69_RS09325 | Protein ID | WP_000550189.1 |
Coordinates | 1827521..1827835 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | E4Z69_RS09320 | Protein ID | WP_000560266.1 |
Coordinates | 1827108..1827524 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E4Z69_RS09310 | 1822168..1824519 | + | 2352 | WP_000695498.1 | alpha-glucosidase | - |
E4Z69_RS09315 | 1825045..1827063 | + | 2019 | WP_000121421.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
E4Z69_RS09320 | 1827108..1827524 | - | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
E4Z69_RS09325 | 1827521..1827835 | - | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
E4Z69_RS09330 | 1828120..1829256 | - | 1137 | WP_000018697.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
E4Z69_RS09335 | 1829342..1829845 | + | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
E4Z69_RS09340 | 1829922..1830605 | + | 684 | WP_001183040.1 | vancomycin high temperature exclusion protein | - |
E4Z69_RS09345 | 1830684..1831670 | + | 987 | WP_001301393.1 | Gfo/Idh/MocA family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T288391 WP_000550189.1 NZ_LR536430:c1827835-1827521 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT288391 WP_000560266.1 NZ_LR536430:c1827524-1827108 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|