Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 1728142..1728835 | Replicon | chromosome |
Accession | NZ_LR536430 | ||
Organism | Escherichia coli isolate f974b26a-5e81-11e8-bf7f-3c4a9275d6c8 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | E4Z69_RS08820 | Protein ID | WP_000415584.1 |
Coordinates | 1728539..1728835 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | E4Z69_RS08815 | Protein ID | WP_000650107.1 |
Coordinates | 1728142..1728537 (-) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E4Z69_RS08805 | 1724006..1726264 | - | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
E4Z69_RS08810 | 1726402..1728009 | - | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
E4Z69_RS08815 | 1728142..1728537 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
E4Z69_RS08820 | 1728539..1728835 | - | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
E4Z69_RS08825 | 1729040..1729522 | - | 483 | WP_000609258.1 | GyrI-like domain-containing protein | - |
E4Z69_RS08830 | 1729575..1729967 | - | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
E4Z69_RS08835 | 1730119..1730778 | + | 660 | WP_001221493.1 | two-component system response regulator QseB | - |
E4Z69_RS08840 | 1730775..1732124 | + | 1350 | WP_000673402.1 | two-component system sensor histidine kinase QseC | - |
E4Z69_RS08845 | 1732170..1732502 | - | 333 | WP_000914691.1 | DUF2645 family protein | - |
E4Z69_RS08850 | 1732509..1733701 | - | 1193 | Protein_1705 | Hcp family type VI secretion system effector | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T288389 WP_000415584.1 NZ_LR536430:c1728835-1728539 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT288389 WP_000650107.1 NZ_LR536430:c1728537-1728142 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|