Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ralRA/- |
Location | 250368..250739 | Replicon | chromosome |
Accession | NZ_LR536430 | ||
Organism | Escherichia coli isolate f974b26a-5e81-11e8-bf7f-3c4a9275d6c8 |
Toxin (Protein)
Gene name | ralR | Uniprot ID | F4VC37 |
Locus tag | E4Z69_RS01375 | Protein ID | WP_001317028.1 |
Coordinates | 250545..250739 (-) | Length | 65 a.a. |
Antitoxin (RNA)
Gene name | ralA | ||
Locus tag | - | ||
Coordinates | 250368..250546 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E4Z69_RS01350 | 246323..247696 | + | 1374 | WP_000123745.1 | ATP-dependent RNA helicase DbpA | - |
E4Z69_RS01355 | 247825..248760 | - | 936 | WP_001157407.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
E4Z69_RS01360 | 248812..250047 | - | 1236 | WP_000040852.1 | site-specific integrase | - |
E4Z69_RS01365 | 250049..250264 | - | 216 | WP_000079604.1 | excisionase XisR | - |
E4Z69_RS01370 | 250343..250552 | - | 210 | WP_000276809.1 | double-strand break reduction protein RcbA | - |
- | 250368..250546 | + | 179 | NuclAT_0 | - | Antitoxin |
- | 250368..250546 | + | 179 | NuclAT_0 | - | Antitoxin |
- | 250368..250546 | + | 179 | NuclAT_0 | - | Antitoxin |
- | 250368..250546 | + | 179 | NuclAT_0 | - | Antitoxin |
E4Z69_RS01375 | 250545..250739 | - | 195 | WP_001317028.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
E4Z69_RS01380 | 250796..251605 | - | 810 | WP_000166319.1 | recombination protein RecT | - |
E4Z69_RS01385 | 251598..254198 | - | 2601 | WP_001549183.1 | exodeoxyribonuclease VIII | - |
E4Z69_RS01390 | 254300..254575 | - | 276 | WP_000632297.1 | protein RacC | - |
E4Z69_RS01395 | 254650..254820 | - | 171 | WP_001352098.1 | conserved protein, Rac prophage | - |
E4Z69_RS01400 | 254820..255041 | - | 222 | WP_000560223.1 | killing protein KilR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 248812..260063 | 11251 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 65 a.a. Molecular weight: 7018.89 Da Isoelectric Point: 8.9538
>T288377 WP_001317028.1 NZ_LR536430:c250739-250545 [Escherichia coli]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALERWNKRTTGNNNGGVHV
Download Length: 195 bp
Antitoxin
Download Length: 179 bp
>AT288377 NZ_LR536430:250368-250546 [Escherichia coli]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAATTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAATTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|