Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 1062523..1063120 | Replicon | chromosome |
Accession | NZ_LR535679 | ||
Organism | Campylobacter showae isolate B91_SC |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | E4V70_RS05275 | Protein ID | WP_197730461.1 |
Coordinates | 1062797..1063120 (-) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | E4V70_RS05270 | Protein ID | WP_103641294.1 |
Coordinates | 1062523..1062804 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E4V70_RS05255 | 1058324..1059784 | + | 1461 | WP_122863391.1 | aldehyde dehydrogenase family protein | - |
E4V70_RS10720 | 1059830..1059982 | - | 153 | WP_163026479.1 | hypothetical protein | - |
E4V70_RS05260 | 1060025..1060864 | - | 840 | WP_122863390.1 | DUF364 domain-containing protein | - |
E4V70_RS05265 | 1061321..1062439 | + | 1119 | WP_122863389.1 | tyrosine-type recombinase/integrase | - |
E4V70_RS05270 | 1062523..1062804 | - | 282 | WP_103641294.1 | helix-turn-helix domain-containing protein | Antitoxin |
E4V70_RS05275 | 1062797..1063120 | - | 324 | WP_197730461.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
E4V70_RS05280 | 1063541..1063771 | + | 231 | WP_122863388.1 | hypothetical protein | - |
E4V70_RS05285 | 1063802..1065427 | + | 1626 | WP_134482483.1 | hypothetical protein | - |
E4V70_RS10725 | 1065754..1065921 | + | 168 | WP_163026478.1 | hypothetical protein | - |
E4V70_RS05290 | 1065931..1066668 | + | 738 | WP_122863386.1 | disulfide bond formation protein B | - |
E4V70_RS05295 | 1066677..1067564 | + | 888 | WP_122863385.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12264.40 Da Isoelectric Point: 10.2170
>T288372 WP_197730461.1 NZ_LR535679:c1063120-1062797 [Campylobacter showae]
MWEITFLDDRVAEEFKALPPKISANMTHIFKLLRLYGNQVGEPQTKSLGDGLFEIRAKGAEGIGRGIFCYMTGRRIYILH
VFVKKGDRIPQKELDIAKNRLKELKNA
MWEITFLDDRVAEEFKALPPKISANMTHIFKLLRLYGNQVGEPQTKSLGDGLFEIRAKGAEGIGRGIFCYMTGRRIYILH
VFVKKGDRIPQKELDIAKNRLKELKNA
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|