Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-OrzO/Ldr(toxin)
Location 2512789..2513011 Replicon chromosome
Accession NZ_LR217818
Organism Escherichia coli strain NCTC86

Toxin (Protein)


Gene name ldrD Uniprot ID D3H2K1
Locus tag E4V11_RS12345 Protein ID WP_000170955.1
Coordinates 2512789..2512896 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name OrzO
Locus tag -
Coordinates 2512944..2513011 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E4V11_RS12315 2508645..2509478 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
E4V11_RS12320 2509475..2509867 + 393 WP_000200374.1 invasion regulator SirB2 -
E4V11_RS12325 2509871..2510680 + 810 WP_001257044.1 invasion regulator SirB1 -
E4V11_RS12330 2510716..2511570 + 855 WP_000811052.1 3-deoxy-8-phosphooctulonate synthase -
E4V11_RS12335 2511719..2511826 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 2511874..2511940 + 67 NuclAT_32 - -
- 2511874..2511940 + 67 NuclAT_32 - -
- 2511874..2511940 + 67 NuclAT_32 - -
- 2511874..2511940 + 67 NuclAT_32 - -
- 2511874..2511940 + 67 NuclAT_34 - -
- 2511874..2511940 + 67 NuclAT_34 - -
- 2511874..2511940 + 67 NuclAT_34 - -
- 2511874..2511940 + 67 NuclAT_34 - -
- 2511874..2511940 + 67 NuclAT_36 - -
- 2511874..2511940 + 67 NuclAT_36 - -
- 2511874..2511940 + 67 NuclAT_36 - -
- 2511874..2511940 + 67 NuclAT_36 - -
- 2511874..2511940 + 67 NuclAT_38 - -
- 2511874..2511940 + 67 NuclAT_38 - -
- 2511874..2511940 + 67 NuclAT_38 - -
- 2511874..2511940 + 67 NuclAT_38 - -
- 2511874..2511940 + 67 NuclAT_40 - -
- 2511874..2511940 + 67 NuclAT_40 - -
- 2511874..2511940 + 67 NuclAT_40 - -
- 2511874..2511940 + 67 NuclAT_40 - -
- 2511874..2511940 + 67 NuclAT_42 - -
- 2511874..2511940 + 67 NuclAT_42 - -
- 2511874..2511940 + 67 NuclAT_42 - -
- 2511874..2511940 + 67 NuclAT_42 - -
- 2511876..2511941 + 66 NuclAT_16 - -
- 2511876..2511941 + 66 NuclAT_16 - -
- 2511876..2511941 + 66 NuclAT_16 - -
- 2511876..2511941 + 66 NuclAT_16 - -
- 2511876..2511941 + 66 NuclAT_19 - -
- 2511876..2511941 + 66 NuclAT_19 - -
- 2511876..2511941 + 66 NuclAT_19 - -
- 2511876..2511941 + 66 NuclAT_19 - -
- 2511876..2511941 + 66 NuclAT_22 - -
- 2511876..2511941 + 66 NuclAT_22 - -
- 2511876..2511941 + 66 NuclAT_22 - -
- 2511876..2511941 + 66 NuclAT_22 - -
- 2511876..2511941 + 66 NuclAT_25 - -
- 2511876..2511941 + 66 NuclAT_25 - -
- 2511876..2511941 + 66 NuclAT_25 - -
- 2511876..2511941 + 66 NuclAT_25 - -
- 2511876..2511941 + 66 NuclAT_28 - -
- 2511876..2511941 + 66 NuclAT_28 - -
- 2511876..2511941 + 66 NuclAT_28 - -
- 2511876..2511941 + 66 NuclAT_28 - -
- 2511876..2511941 + 66 NuclAT_31 - -
- 2511876..2511941 + 66 NuclAT_31 - -
- 2511876..2511941 + 66 NuclAT_31 - -
- 2511876..2511941 + 66 NuclAT_31 - -
E4V11_RS12340 2512254..2512361 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 2512409..2512475 + 67 NuclAT_33 - -
- 2512409..2512475 + 67 NuclAT_33 - -
- 2512409..2512475 + 67 NuclAT_33 - -
- 2512409..2512475 + 67 NuclAT_33 - -
- 2512409..2512475 + 67 NuclAT_35 - -
- 2512409..2512475 + 67 NuclAT_35 - -
- 2512409..2512475 + 67 NuclAT_35 - -
- 2512409..2512475 + 67 NuclAT_35 - -
- 2512409..2512475 + 67 NuclAT_37 - -
- 2512409..2512475 + 67 NuclAT_37 - -
- 2512409..2512475 + 67 NuclAT_37 - -
- 2512409..2512475 + 67 NuclAT_37 - -
- 2512409..2512475 + 67 NuclAT_39 - -
- 2512409..2512475 + 67 NuclAT_39 - -
- 2512409..2512475 + 67 NuclAT_39 - -
- 2512409..2512475 + 67 NuclAT_39 - -
- 2512409..2512475 + 67 NuclAT_41 - -
- 2512409..2512475 + 67 NuclAT_41 - -
- 2512409..2512475 + 67 NuclAT_41 - -
- 2512409..2512475 + 67 NuclAT_41 - -
- 2512409..2512475 + 67 NuclAT_43 - -
- 2512409..2512475 + 67 NuclAT_43 - -
- 2512409..2512475 + 67 NuclAT_43 - -
- 2512409..2512475 + 67 NuclAT_43 - -
- 2512411..2512476 + 66 NuclAT_15 - -
- 2512411..2512476 + 66 NuclAT_15 - -
- 2512411..2512476 + 66 NuclAT_15 - -
- 2512411..2512476 + 66 NuclAT_15 - -
- 2512411..2512476 + 66 NuclAT_18 - -
- 2512411..2512476 + 66 NuclAT_18 - -
- 2512411..2512476 + 66 NuclAT_18 - -
- 2512411..2512476 + 66 NuclAT_18 - -
- 2512411..2512476 + 66 NuclAT_21 - -
- 2512411..2512476 + 66 NuclAT_21 - -
- 2512411..2512476 + 66 NuclAT_21 - -
- 2512411..2512476 + 66 NuclAT_21 - -
- 2512411..2512476 + 66 NuclAT_24 - -
- 2512411..2512476 + 66 NuclAT_24 - -
- 2512411..2512476 + 66 NuclAT_24 - -
- 2512411..2512476 + 66 NuclAT_24 - -
- 2512411..2512476 + 66 NuclAT_27 - -
- 2512411..2512476 + 66 NuclAT_27 - -
- 2512411..2512476 + 66 NuclAT_27 - -
- 2512411..2512476 + 66 NuclAT_27 - -
- 2512411..2512476 + 66 NuclAT_30 - -
- 2512411..2512476 + 66 NuclAT_30 - -
- 2512411..2512476 + 66 NuclAT_30 - -
- 2512411..2512476 + 66 NuclAT_30 - -
E4V11_RS12345 2512789..2512896 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC Toxin
- 2512944..2513011 + 68 NuclAT_14 - Antitoxin
- 2512944..2513011 + 68 NuclAT_14 - Antitoxin
- 2512944..2513011 + 68 NuclAT_14 - Antitoxin
- 2512944..2513011 + 68 NuclAT_14 - Antitoxin
- 2512944..2513011 + 68 NuclAT_17 - Antitoxin
- 2512944..2513011 + 68 NuclAT_17 - Antitoxin
- 2512944..2513011 + 68 NuclAT_17 - Antitoxin
- 2512944..2513011 + 68 NuclAT_17 - Antitoxin
- 2512944..2513011 + 68 NuclAT_20 - Antitoxin
- 2512944..2513011 + 68 NuclAT_20 - Antitoxin
- 2512944..2513011 + 68 NuclAT_20 - Antitoxin
- 2512944..2513011 + 68 NuclAT_20 - Antitoxin
- 2512944..2513011 + 68 NuclAT_23 - Antitoxin
- 2512944..2513011 + 68 NuclAT_23 - Antitoxin
- 2512944..2513011 + 68 NuclAT_23 - Antitoxin
- 2512944..2513011 + 68 NuclAT_23 - Antitoxin
- 2512944..2513011 + 68 NuclAT_26 - Antitoxin
- 2512944..2513011 + 68 NuclAT_26 - Antitoxin
- 2512944..2513011 + 68 NuclAT_26 - Antitoxin
- 2512944..2513011 + 68 NuclAT_26 - Antitoxin
- 2512944..2513011 + 68 NuclAT_29 - Antitoxin
- 2512944..2513011 + 68 NuclAT_29 - Antitoxin
- 2512944..2513011 + 68 NuclAT_29 - Antitoxin
- 2512944..2513011 + 68 NuclAT_29 - Antitoxin
E4V11_RS12355 2513300..2514400 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
E4V11_RS12360 2514670..2514900 + 231 WP_001146444.1 putative cation transport regulator ChaB -
E4V11_RS12365 2515058..2515753 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
E4V11_RS12370 2515797..2516150 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
E4V11_RS12375 2516335..2517729 + 1395 WP_000086217.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4013.82 Da        Isoelectric Point: 11.4779

>T288357 WP_000170955.1 NZ_LR217818:c2512896-2512789 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 68 bp

>AT288357 NZ_LR217818:2512944-2513011 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829J2A9

Antitoxin

Download structure file

References