Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-OrzO/Ldr(toxin) |
| Location | 2512789..2513011 | Replicon | chromosome |
| Accession | NZ_LR217818 | ||
| Organism | Escherichia coli strain NCTC86 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | D3H2K1 |
| Locus tag | E4V11_RS12345 | Protein ID | WP_000170955.1 |
| Coordinates | 2512789..2512896 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | OrzO | ||
| Locus tag | - | ||
| Coordinates | 2512944..2513011 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E4V11_RS12315 | 2508645..2509478 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| E4V11_RS12320 | 2509475..2509867 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
| E4V11_RS12325 | 2509871..2510680 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| E4V11_RS12330 | 2510716..2511570 | + | 855 | WP_000811052.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| E4V11_RS12335 | 2511719..2511826 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | - |
| - | 2511874..2511940 | + | 67 | NuclAT_32 | - | - |
| - | 2511874..2511940 | + | 67 | NuclAT_32 | - | - |
| - | 2511874..2511940 | + | 67 | NuclAT_32 | - | - |
| - | 2511874..2511940 | + | 67 | NuclAT_32 | - | - |
| - | 2511874..2511940 | + | 67 | NuclAT_34 | - | - |
| - | 2511874..2511940 | + | 67 | NuclAT_34 | - | - |
| - | 2511874..2511940 | + | 67 | NuclAT_34 | - | - |
| - | 2511874..2511940 | + | 67 | NuclAT_34 | - | - |
| - | 2511874..2511940 | + | 67 | NuclAT_36 | - | - |
| - | 2511874..2511940 | + | 67 | NuclAT_36 | - | - |
| - | 2511874..2511940 | + | 67 | NuclAT_36 | - | - |
| - | 2511874..2511940 | + | 67 | NuclAT_36 | - | - |
| - | 2511874..2511940 | + | 67 | NuclAT_38 | - | - |
| - | 2511874..2511940 | + | 67 | NuclAT_38 | - | - |
| - | 2511874..2511940 | + | 67 | NuclAT_38 | - | - |
| - | 2511874..2511940 | + | 67 | NuclAT_38 | - | - |
| - | 2511874..2511940 | + | 67 | NuclAT_40 | - | - |
| - | 2511874..2511940 | + | 67 | NuclAT_40 | - | - |
| - | 2511874..2511940 | + | 67 | NuclAT_40 | - | - |
| - | 2511874..2511940 | + | 67 | NuclAT_40 | - | - |
| - | 2511874..2511940 | + | 67 | NuclAT_42 | - | - |
| - | 2511874..2511940 | + | 67 | NuclAT_42 | - | - |
| - | 2511874..2511940 | + | 67 | NuclAT_42 | - | - |
| - | 2511874..2511940 | + | 67 | NuclAT_42 | - | - |
| - | 2511876..2511941 | + | 66 | NuclAT_16 | - | - |
| - | 2511876..2511941 | + | 66 | NuclAT_16 | - | - |
| - | 2511876..2511941 | + | 66 | NuclAT_16 | - | - |
| - | 2511876..2511941 | + | 66 | NuclAT_16 | - | - |
| - | 2511876..2511941 | + | 66 | NuclAT_19 | - | - |
| - | 2511876..2511941 | + | 66 | NuclAT_19 | - | - |
| - | 2511876..2511941 | + | 66 | NuclAT_19 | - | - |
| - | 2511876..2511941 | + | 66 | NuclAT_19 | - | - |
| - | 2511876..2511941 | + | 66 | NuclAT_22 | - | - |
| - | 2511876..2511941 | + | 66 | NuclAT_22 | - | - |
| - | 2511876..2511941 | + | 66 | NuclAT_22 | - | - |
| - | 2511876..2511941 | + | 66 | NuclAT_22 | - | - |
| - | 2511876..2511941 | + | 66 | NuclAT_25 | - | - |
| - | 2511876..2511941 | + | 66 | NuclAT_25 | - | - |
| - | 2511876..2511941 | + | 66 | NuclAT_25 | - | - |
| - | 2511876..2511941 | + | 66 | NuclAT_25 | - | - |
| - | 2511876..2511941 | + | 66 | NuclAT_28 | - | - |
| - | 2511876..2511941 | + | 66 | NuclAT_28 | - | - |
| - | 2511876..2511941 | + | 66 | NuclAT_28 | - | - |
| - | 2511876..2511941 | + | 66 | NuclAT_28 | - | - |
| - | 2511876..2511941 | + | 66 | NuclAT_31 | - | - |
| - | 2511876..2511941 | + | 66 | NuclAT_31 | - | - |
| - | 2511876..2511941 | + | 66 | NuclAT_31 | - | - |
| - | 2511876..2511941 | + | 66 | NuclAT_31 | - | - |
| E4V11_RS12340 | 2512254..2512361 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | - |
| - | 2512409..2512475 | + | 67 | NuclAT_33 | - | - |
| - | 2512409..2512475 | + | 67 | NuclAT_33 | - | - |
| - | 2512409..2512475 | + | 67 | NuclAT_33 | - | - |
| - | 2512409..2512475 | + | 67 | NuclAT_33 | - | - |
| - | 2512409..2512475 | + | 67 | NuclAT_35 | - | - |
| - | 2512409..2512475 | + | 67 | NuclAT_35 | - | - |
| - | 2512409..2512475 | + | 67 | NuclAT_35 | - | - |
| - | 2512409..2512475 | + | 67 | NuclAT_35 | - | - |
| - | 2512409..2512475 | + | 67 | NuclAT_37 | - | - |
| - | 2512409..2512475 | + | 67 | NuclAT_37 | - | - |
| - | 2512409..2512475 | + | 67 | NuclAT_37 | - | - |
| - | 2512409..2512475 | + | 67 | NuclAT_37 | - | - |
| - | 2512409..2512475 | + | 67 | NuclAT_39 | - | - |
| - | 2512409..2512475 | + | 67 | NuclAT_39 | - | - |
| - | 2512409..2512475 | + | 67 | NuclAT_39 | - | - |
| - | 2512409..2512475 | + | 67 | NuclAT_39 | - | - |
| - | 2512409..2512475 | + | 67 | NuclAT_41 | - | - |
| - | 2512409..2512475 | + | 67 | NuclAT_41 | - | - |
| - | 2512409..2512475 | + | 67 | NuclAT_41 | - | - |
| - | 2512409..2512475 | + | 67 | NuclAT_41 | - | - |
| - | 2512409..2512475 | + | 67 | NuclAT_43 | - | - |
| - | 2512409..2512475 | + | 67 | NuclAT_43 | - | - |
| - | 2512409..2512475 | + | 67 | NuclAT_43 | - | - |
| - | 2512409..2512475 | + | 67 | NuclAT_43 | - | - |
| - | 2512411..2512476 | + | 66 | NuclAT_15 | - | - |
| - | 2512411..2512476 | + | 66 | NuclAT_15 | - | - |
| - | 2512411..2512476 | + | 66 | NuclAT_15 | - | - |
| - | 2512411..2512476 | + | 66 | NuclAT_15 | - | - |
| - | 2512411..2512476 | + | 66 | NuclAT_18 | - | - |
| - | 2512411..2512476 | + | 66 | NuclAT_18 | - | - |
| - | 2512411..2512476 | + | 66 | NuclAT_18 | - | - |
| - | 2512411..2512476 | + | 66 | NuclAT_18 | - | - |
| - | 2512411..2512476 | + | 66 | NuclAT_21 | - | - |
| - | 2512411..2512476 | + | 66 | NuclAT_21 | - | - |
| - | 2512411..2512476 | + | 66 | NuclAT_21 | - | - |
| - | 2512411..2512476 | + | 66 | NuclAT_21 | - | - |
| - | 2512411..2512476 | + | 66 | NuclAT_24 | - | - |
| - | 2512411..2512476 | + | 66 | NuclAT_24 | - | - |
| - | 2512411..2512476 | + | 66 | NuclAT_24 | - | - |
| - | 2512411..2512476 | + | 66 | NuclAT_24 | - | - |
| - | 2512411..2512476 | + | 66 | NuclAT_27 | - | - |
| - | 2512411..2512476 | + | 66 | NuclAT_27 | - | - |
| - | 2512411..2512476 | + | 66 | NuclAT_27 | - | - |
| - | 2512411..2512476 | + | 66 | NuclAT_27 | - | - |
| - | 2512411..2512476 | + | 66 | NuclAT_30 | - | - |
| - | 2512411..2512476 | + | 66 | NuclAT_30 | - | - |
| - | 2512411..2512476 | + | 66 | NuclAT_30 | - | - |
| - | 2512411..2512476 | + | 66 | NuclAT_30 | - | - |
| E4V11_RS12345 | 2512789..2512896 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | Toxin |
| - | 2512944..2513011 | + | 68 | NuclAT_14 | - | Antitoxin |
| - | 2512944..2513011 | + | 68 | NuclAT_14 | - | Antitoxin |
| - | 2512944..2513011 | + | 68 | NuclAT_14 | - | Antitoxin |
| - | 2512944..2513011 | + | 68 | NuclAT_14 | - | Antitoxin |
| - | 2512944..2513011 | + | 68 | NuclAT_17 | - | Antitoxin |
| - | 2512944..2513011 | + | 68 | NuclAT_17 | - | Antitoxin |
| - | 2512944..2513011 | + | 68 | NuclAT_17 | - | Antitoxin |
| - | 2512944..2513011 | + | 68 | NuclAT_17 | - | Antitoxin |
| - | 2512944..2513011 | + | 68 | NuclAT_20 | - | Antitoxin |
| - | 2512944..2513011 | + | 68 | NuclAT_20 | - | Antitoxin |
| - | 2512944..2513011 | + | 68 | NuclAT_20 | - | Antitoxin |
| - | 2512944..2513011 | + | 68 | NuclAT_20 | - | Antitoxin |
| - | 2512944..2513011 | + | 68 | NuclAT_23 | - | Antitoxin |
| - | 2512944..2513011 | + | 68 | NuclAT_23 | - | Antitoxin |
| - | 2512944..2513011 | + | 68 | NuclAT_23 | - | Antitoxin |
| - | 2512944..2513011 | + | 68 | NuclAT_23 | - | Antitoxin |
| - | 2512944..2513011 | + | 68 | NuclAT_26 | - | Antitoxin |
| - | 2512944..2513011 | + | 68 | NuclAT_26 | - | Antitoxin |
| - | 2512944..2513011 | + | 68 | NuclAT_26 | - | Antitoxin |
| - | 2512944..2513011 | + | 68 | NuclAT_26 | - | Antitoxin |
| - | 2512944..2513011 | + | 68 | NuclAT_29 | - | Antitoxin |
| - | 2512944..2513011 | + | 68 | NuclAT_29 | - | Antitoxin |
| - | 2512944..2513011 | + | 68 | NuclAT_29 | - | Antitoxin |
| - | 2512944..2513011 | + | 68 | NuclAT_29 | - | Antitoxin |
| E4V11_RS12355 | 2513300..2514400 | - | 1101 | WP_000063607.1 | sodium-potassium/proton antiporter ChaA | - |
| E4V11_RS12360 | 2514670..2514900 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| E4V11_RS12365 | 2515058..2515753 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| E4V11_RS12370 | 2515797..2516150 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| E4V11_RS12375 | 2516335..2517729 | + | 1395 | WP_000086217.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4013.82 Da Isoelectric Point: 11.4779
>T288357 WP_000170955.1 NZ_LR217818:c2512896-2512789 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 68 bp
>AT288357 NZ_LR217818:2512944-2513011 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|