Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 1314639..1315333 | Replicon | chromosome |
Accession | NZ_LR217818 | ||
Organism | Escherichia coli strain NCTC86 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | A0A3P5GWS5 |
Locus tag | E4V11_RS06390 | Protein ID | WP_001263488.1 |
Coordinates | 1314935..1315333 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | E4V11_RS06385 | Protein ID | WP_000554758.1 |
Coordinates | 1314639..1314932 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E4V11_RS06365 | 1310271..1310768 | + | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
E4V11_RS06370 | 1310992..1312704 | - | 1713 | Protein_1227 | flagellar biosynthesis protein FlhA | - |
E4V11_RS06375 | 1312676..1313461 | + | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
E4V11_RS06380 | 1313532..1314587 | + | 1056 | WP_001226164.1 | DNA polymerase IV | - |
E4V11_RS06385 | 1314639..1314932 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
E4V11_RS06390 | 1314935..1315333 | + | 399 | WP_001263488.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
E4V11_RS06395 | 1315343..1315795 | + | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
E4V11_RS06400 | 1316113..1316319 | + | 207 | Protein_1233 | RtcB family protein | - |
E4V11_RS06405 | 1316315..1316836 | + | 522 | Protein_1234 | peptide chain release factor H | - |
E4V11_RS06410 | 1316893..1318350 | - | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
E4V11_RS06415 | 1318611..1319069 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
- | 1319665..1319745 | + | 81 | NuclAT_12 | - | - |
- | 1319665..1319745 | + | 81 | NuclAT_12 | - | - |
- | 1319665..1319745 | + | 81 | NuclAT_12 | - | - |
- | 1319665..1319745 | + | 81 | NuclAT_12 | - | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | gmhA/lpcA | 1300876..1331614 | 30738 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15559.90 Da Isoelectric Point: 6.9798
>T288351 WP_001263488.1 NZ_LR217818:1314935-1315333 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQEAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQEAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3P5GWS5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |