Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3473940..3474634 | Replicon | chromosome |
Accession | NZ_LR215973 | ||
Organism | Nocardia cyriacigeorgica strain 3012STDY6756504 |
Toxin (Protein)
Gene name | HigB2 | Uniprot ID | - |
Locus tag | E0E67_RS16025 | Protein ID | WP_130917663.1 |
Coordinates | 3474269..3474634 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | E0E67_RS16020 | Protein ID | WP_130917662.1 |
Coordinates | 3473940..3474272 (-) | Length | 111 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E0E67_RS16005 | 3470131..3471078 | + | 948 | WP_130917660.1 | 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase | - |
E0E67_RS29460 | 3471239..3472729 | + | 1491 | WP_197731549.1 | serine/threonine protein kinase | - |
E0E67_RS16015 | 3472705..3473922 | + | 1218 | WP_130917661.1 | hypothetical protein | - |
E0E67_RS16020 | 3473940..3474272 | - | 333 | WP_130917662.1 | helix-turn-helix domain-containing protein | Antitoxin |
E0E67_RS16025 | 3474269..3474634 | - | 366 | WP_130917663.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
E0E67_RS16030 | 3474703..3476130 | - | 1428 | WP_197731550.1 | acyl-CoA synthetase | - |
E0E67_RS16035 | 3476298..3477149 | + | 852 | WP_130917664.1 | DUF2236 domain-containing protein | - |
E0E67_RS16040 | 3477170..3477796 | - | 627 | WP_036539457.1 | TetR/AcrR family transcriptional regulator | - |
E0E67_RS16045 | 3477928..3478788 | + | 861 | WP_197731551.1 | DUF2236 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13576.26 Da Isoelectric Point: 4.6636
>T288324 WP_130917663.1 NZ_LR215973:c3474634-3474269 [Nocardia cyriacigeorgica]
VNWEVVLHSEVESWYLAVCVSDPETGDLIEDALDQLAAEGPAAGRPLVDRIKGSEFHNMKELRPPSSGTSEVRMLFAFDP
ARQVIVLVAGDKSGNWQGWYREAIRLADKRFAEHLAAREER
VNWEVVLHSEVESWYLAVCVSDPETGDLIEDALDQLAAEGPAAGRPLVDRIKGSEFHNMKELRPPSSGTSEVRMLFAFDP
ARQVIVLVAGDKSGNWQGWYREAIRLADKRFAEHLAAREER
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|