Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/Txe-RelB
Location 2141871..2142376 Replicon chromosome
Accession NZ_LR214441
Organism Tessaracoccus lapidicaptus isolate TLA_E

Toxin (Protein)


Gene name yoeB Uniprot ID -
Locus tag TLA_RS09785 Protein ID WP_078919985.1
Coordinates 2141871..2142137 (-) Length 89 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID -
Locus tag TLA_RS09790 Protein ID WP_078919986.1
Coordinates 2142134..2142376 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
TLA_RS09750 2137378..2137875 + 498 WP_068750332.1 hypothetical protein -
TLA_RS09755 2138265..2138768 + 504 WP_068750330.1 metallophosphatase family protein -
TLA_RS09760 2138836..2139219 + 384 WP_068750328.1 alcohol dehydrogenase -
TLA_RS09765 2139298..2139582 + 285 WP_188426943.1 hypothetical protein -
TLA_RS09770 2139666..2140058 - 393 WP_068750324.1 type II toxin-antitoxin system VapC family toxin -
TLA_RS09775 2140055..2140282 - 228 WP_068750322.1 antitoxin -
TLA_RS09780 2140365..2141603 - 1239 WP_078919578.1 IS110 family transposase -
TLA_RS09785 2141871..2142137 - 267 WP_078919985.1 Txe/YoeB family addiction module toxin Toxin
TLA_RS09790 2142134..2142376 - 243 WP_078919986.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
TLA_RS09795 2142535..2143296 + 762 WP_078919987.1 aldo/keto reductase -
TLA_RS09800 2143705..2144079 + 375 WP_078919988.1 DUF2200 domain-containing protein -
TLA_RS09805 2144076..2144477 + 402 WP_078919989.1 hypothetical protein -
TLA_RS09810 2144629..2144919 + 291 WP_141679993.1 hypothetical protein -
TLA_RS09815 2144955..2145176 + 222 WP_078919990.1 hypothetical protein -
TLA_RS09820 2145288..2146499 + 1212 WP_078919991.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(9-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-68)


Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10205.93 Da        Isoelectric Point: 10.0709

>T288317 WP_078919985.1 NZ_LR214441:c2142137-2141871 [Tessaracoccus lapidicaptus]
VNSWTLVYSRQAQKDAKKLASPGLKTKAQHLLEVLAQDPFTTPPKYEKLVGALVGCYSRRINIQHRLVYEVLPERHVVHI
LRMWTHCE

Download         Length: 267 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8716.65 Da        Isoelectric Point: 3.9557

>AT288317 WP_078919986.1 NZ_LR214441:c2142376-2142134 [Tessaracoccus lapidicaptus]
MTAVNATSARANLYRLIDQVNEESEPLTITGQRGNAVLVGEEDWLAIQETLFLESVPGLAESIRRARAEGVDAGSTELDW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References