Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-RelB |
Location | 1671212..1671717 | Replicon | chromosome |
Accession | NZ_LR214441 | ||
Organism | Tessaracoccus lapidicaptus isolate TLA_E |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | - |
Locus tag | TLA_RS07715 | Protein ID | WP_078919878.1 |
Coordinates | 1671212..1671478 (-) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | TLA_RS07720 | Protein ID | WP_076063562.1 |
Coordinates | 1671475..1671717 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
TLA_RS07700 | 1667073..1668032 | - | 960 | WP_078919875.1 | aldo/keto reductase | - |
TLA_RS07705 | 1668903..1669655 | + | 753 | WP_078919877.1 | potassium channel family protein | - |
TLA_RS07710 | 1669706..1670944 | - | 1239 | WP_078919578.1 | IS110 family transposase | - |
TLA_RS07715 | 1671212..1671478 | - | 267 | WP_078919878.1 | Txe/YoeB family addiction module toxin | Toxin |
TLA_RS07720 | 1671475..1671717 | - | 243 | WP_076063562.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
TLA_RS07725 | 1671903..1674164 | - | 2262 | WP_197971720.1 | pyruvate dehydrogenase | - |
TLA_RS07730 | 1674252..1675088 | - | 837 | WP_078919880.1 | carbohydrate ABC transporter permease | - |
TLA_RS07735 | 1675085..1675882 | - | 798 | WP_078920441.1 | sugar ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10265.97 Da Isoelectric Point: 10.1636
>T288316 WP_078919878.1 NZ_LR214441:c1671478-1671212 [Tessaracoccus lapidicaptus]
VNSWTLVYSRQAQKDAKKLASPGLKTKAQHLLEVLAQDPFTTPPKYEKLVGALVGCYSRRINIQHRLVYEVLPERHVVHI
LRMWTHYE
VNSWTLVYSRQAQKDAKKLASPGLKTKAQHLLEVLAQDPFTTPPKYEKLVGALVGCYSRRINIQHRLVYEVLPERHVVHI
LRMWTHYE
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|