Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) yefM-yoeB (relBE)/Txe-RelB
Location 444139..444644 Replicon chromosome
Accession NZ_LR214441
Organism Tessaracoccus lapidicaptus isolate TLA_E

Toxin (Protein)


Gene name yoeB Uniprot ID A0A1C0AML5
Locus tag TLA_RS02145 Protein ID WP_068751162.1
Coordinates 444139..444405 (-) Length 89 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID A0A1C0AML7
Locus tag TLA_RS02150 Protein ID WP_068751161.1
Coordinates 444402..444644 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
TLA_RS02105 439350..440303 - 954 WP_068751170.1 helix-turn-helix domain-containing protein -
TLA_RS02110 440408..441043 + 636 WP_068751169.1 isochorismatase family protein -
TLA_RS02115 441150..441431 + 282 WP_068751168.1 type II toxin-antitoxin system RelE/ParE family toxin -
TLA_RS02120 441445..441747 + 303 WP_068751167.1 HigA family addiction module antidote protein -
TLA_RS02125 441831..442151 - 321 WP_068751166.1 DUF86 domain-containing protein -
TLA_RS02130 442148..442468 - 321 WP_068751165.1 nucleotidyltransferase domain-containing protein -
TLA_RS02135 442559..443077 - 519 WP_068751164.1 hypothetical protein -
TLA_RS02140 443289..444035 + 747 WP_068751163.1 hypothetical protein -
TLA_RS02145 444139..444405 - 267 WP_068751162.1 Txe/YoeB family addiction module toxin Toxin
TLA_RS02150 444402..444644 - 243 WP_068751161.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
TLA_RS02155 445082..445885 + 804 WP_153302360.1 hypothetical protein -
TLA_RS02160 446164..446460 + 297 WP_153302361.1 hypothetical protein -
TLA_RS02165 447028..447291 - 264 WP_068750402.1 type II toxin-antitoxin system RelE/ParE family toxin -
TLA_RS02170 447288..447551 - 264 WP_197971681.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
TLA_RS02175 447859..449442 + 1584 WP_068750398.1 SDR family NAD(P)-dependent oxidoreductase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 436812..454096 17284


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-68)


Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10111.75 Da        Isoelectric Point: 9.9683

>T288315 WP_068751162.1 NZ_LR214441:c444405-444139 [Tessaracoccus lapidicaptus]
VSPWTLVYSGQAQKDAKKLASSGLKTKAQHLLEVLAQDPFTTPPKYEKLVGALAGCYSRRINIQHRLVYEVLPERHVVHI
LRMWTHYE

Download         Length: 267 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8689.63 Da        Isoelectric Point: 3.9421

>AT288315 WP_068751161.1 NZ_LR214441:c444644-444402 [Tessaracoccus lapidicaptus]
MTAVSATSARANLYRLIDQVNEESEPLTITGQRGNAVLIGEEDWLAIQETLFLESVPGLADSIRRARAEGVDAGSTELDW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1C0AML5

Antitoxin

Source ID Structure
AlphaFold DB A0A1C0AML7

References