288314

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-VapI
Location 441150..441747 Replicon chromosome
Accession NZ_LR214441
Organism Tessaracoccus lapidicaptus isolate TLA_E

Toxin (Protein)


Gene name graT Uniprot ID A0A1C0AMU7
Locus tag TLA_RS02115 Protein ID WP_068751168.1
Coordinates 441150..441431 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID A0A1C0AMI6
Locus tag TLA_RS02120 Protein ID WP_068751167.1
Coordinates 441445..441747 (+) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
TLA_RS02075 436225..436773 + 549 WP_176715187.1 NERD domain-containing protein -
TLA_RS02080 436812..437045 - 234 WP_068751174.1 hypothetical protein -
TLA_RS02085 437178..437693 - 516 WP_197971778.1 AAA family ATPase -
TLA_RS02090 437861..438439 + 579 WP_068751173.1 DUF1697 domain-containing protein -
TLA_RS02095 438410..438688 - 279 WP_068751172.1 helix-turn-helix domain-containing protein -
TLA_RS02100 438705..439229 - 525 WP_141680043.1 hypothetical protein -
TLA_RS02105 439350..440303 - 954 WP_068751170.1 helix-turn-helix domain-containing protein -
TLA_RS02110 440408..441043 + 636 WP_068751169.1 isochorismatase family protein -
TLA_RS02115 441150..441431 + 282 WP_068751168.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
TLA_RS02120 441445..441747 + 303 WP_068751167.1 HigA family addiction module antidote protein Antitoxin
TLA_RS02125 441831..442151 - 321 WP_068751166.1 DUF86 domain-containing protein -
TLA_RS02130 442148..442468 - 321 WP_068751165.1 nucleotidyltransferase domain-containing protein -
TLA_RS02135 442559..443077 - 519 WP_068751164.1 hypothetical protein -
TLA_RS02140 443289..444035 + 747 WP_068751163.1 hypothetical protein -
TLA_RS02145 444139..444405 - 267 WP_068751162.1 Txe/YoeB family addiction module toxin -
TLA_RS02150 444402..444644 - 243 WP_068751161.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
TLA_RS02155 445082..445885 + 804 WP_153302360.1 hypothetical protein -
TLA_RS02160 446164..446460 + 297 WP_153302361.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 436812..454096 17284


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(2-93)

Antitoxin

Toxin-antitoxin system, antidote protein, HigA

(5-97)


Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10890.46 Da        Isoelectric Point: 9.2303

>T288314 WP_068751168.1 NZ_LR214441:441150-441431 [Tessaracoccus lapidicaptus]
VIRSFRDPATERLWSRQRVKSIDPRIERVALRKLVMLDAAEILDDLRIPPGNRLEALRGDRAGQHSIRINQQWRICFTWT
DAGPTDVEIVDYH

Download         Length: 282 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11430.20 Da        Isoelectric Point: 7.3203

>AT288314 WP_068751167.1 NZ_LR214441:441445-441747 [Tessaracoccus lapidicaptus]
MTSTTAIPPIHPGEILMDEFLEPLQISQNRLAVAIGVPPRRINEIVHGKRRITADTALRLARYFGTTDRFWLNLQTRFDL
EVEKDHLGNTLDRIEPLKAV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1C0AMU7

Antitoxin

Source ID Structure
AlphaFold DB A0A1C0AMI6

References