Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4144653..4145380 | Replicon | chromosome |
Accession | NZ_LR213458 | ||
Organism | Shigella sonnei strain AUSMDU00008333 isolate AUSMDU00008333 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | E0E38_RS21025 | Protein ID | WP_000550189.1 |
Coordinates | 4144653..4144967 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | E0E38_RS21030 | Protein ID | WP_000560263.1 |
Coordinates | 4144964..4145380 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E0E38_RS21005 (4140819) | 4140819..4141805 | - | 987 | WP_001446103.1 | Gfo/Idh/MocA family oxidoreductase | - |
E0E38_RS21010 (4141884) | 4141884..4142567 | - | 684 | WP_001183060.1 | vancomycin high temperature exclusion protein | - |
E0E38_RS21015 (4142644) | 4142644..4143147 | - | 504 | WP_001305117.1 | M48 family metallopeptidase | - |
E0E38_RS21020 (4143232) | 4143232..4144368 | + | 1137 | WP_000018685.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
E0E38_RS21025 (4144653) | 4144653..4144967 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
E0E38_RS21030 (4144964) | 4144964..4145380 | + | 417 | WP_000560263.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
E0E38_RS21035 (4145425) | 4145425..4147443 | - | 2019 | WP_000121451.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
E0E38_RS21040 (4147669) | 4147669..4150020 | - | 2352 | Protein_4048 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T288305 WP_000550189.1 NZ_LR213458:4144653-4144967 [Shigella sonnei]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14979.42 Da Isoelectric Point: 4.4547
>AT288305 WP_000560263.1 NZ_LR213458:4144964-4145380 [Shigella sonnei]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLADLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLADLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|