Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 3869008..3869735 | Replicon | chromosome |
Accession | NZ_LR213458 | ||
Organism | Shigella sonnei strain AUSMDU00008333 isolate AUSMDU00008333 |
Toxin (Protein)
Gene name | higB | Uniprot ID | Q3YYE6 |
Locus tag | E0E38_RS19640 | Protein ID | WP_000547563.1 |
Coordinates | 3869424..3869735 (-) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | E0E38_RS19635 | Protein ID | WP_000126296.1 |
Coordinates | 3869008..3869427 (-) | Length | 140 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E0E38_RS19615 (3864059) | 3864059..3864586 | - | 528 | WP_001078766.1 | electron transport protein HydN | - |
E0E38_RS19620 (3864734) | 3864734..3865744 | - | 1011 | WP_001402444.1 | DNA-binding transcriptional regulator AscG | - |
E0E38_RS19625 (3866004) | 3866004..3867461 | + | 1458 | WP_001107890.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
E0E38_RS19630 (3867470) | 3867470..3868894 | + | 1425 | WP_000110319.1 | 6-phospho-beta-glucosidase AscB | - |
E0E38_RS19635 (3869008) | 3869008..3869427 | - | 420 | WP_000126296.1 | helix-turn-helix domain-containing protein | Antitoxin |
E0E38_RS19640 (3869424) | 3869424..3869735 | - | 312 | WP_000547563.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
E0E38_RS19645 (3869897) | 3869897..3870670 | - | 774 | WP_001026444.1 | hypothetical protein | - |
E0E38_RS19650 (3870695) | 3870695..3871165 | - | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
E0E38_RS19655 (3871158) | 3871158..3871568 | - | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
E0E38_RS19660 (3871565) | 3871565..3872332 | - | 768 | WP_000067403.1 | formate hydrogenlyase subunit HycG | - |
E0E38_RS19665 (3872332) | 3872332..3872874 | - | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
E0E38_RS19670 (3872884) | 3872884..3874581 | - | 1698 | WP_001288143.1 | formate hydrogenlyase subunit HycE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12398.11 Da Isoelectric Point: 9.7105
>T288302 WP_000547563.1 NZ_LR213458:c3869735-3869424 [Shigella sonnei]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.38 Da Isoelectric Point: 4.3653
>AT288302 WP_000126296.1 NZ_LR213458:c3869427-3869008 [Shigella sonnei]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNQEFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNQEFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|