Detailed information of TA system TA288289

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 63825..64251
• Replicon: plasmid 3
• Accession: NZ_LR213457
• Organism: Shigella flexneri strain AUSMDU00008332 isolate AUSMDU00008332

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: E0E35_RS25805
• Protein ID: WP_001372321.1
• Coordinates: 63825..63950 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	64027..64251 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
E0E35_RS25765 (58893)	58893..59120	-	228	WP_000589556.1	conjugal transfer relaxosome protein TraY	-
E0E35_RS25770 (59240)	59240..59887	-	648	WP_000332523.1	transcriptional regulator TraJ family protein	-
E0E35_RS25775 (60079)	60079..60462	-	384	WP_001151529.1	conjugal transfer relaxosome DNA-binding protein TraM	-
E0E35_RS25780 (60795)	60795..61385	+	591	WP_000252683.1	transglycosylase SLT domain-containing protein	-
E0E35_RS25785 (61682)	61682..62503	-	822	WP_001234445.1	DUF932 domain-containing protein	-
E0E35_RS25790 (62614)	62614..62910	-	297	WP_001272251.1	hypothetical protein	-
E0E35_RS25800 (63210)	63210..63506	+	297	Protein_79	hypothetical protein	-
E0E35_RS25805 (63825)	63825..63950	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
E0E35_RS27030 (63892)	63892..64041	-	150	Protein_81	plasmid maintenance protein Mok	-
E0E35_RS25810 (64063)	64063..64242	+	180	WP_001334662.1	hypothetical protein	-
- (64027)	64027..64251	-	225	NuclAT_0	-	Antitoxin
- (64027)	64027..64251	-	225	NuclAT_0	-	Antitoxin
- (64027)	64027..64251	-	225	NuclAT_0	-	Antitoxin
- (64027)	64027..64251	-	225	NuclAT_0	-	Antitoxin
E0E35_RS25815 (64220)	64220..64982	-	763	Protein_83	plasmid SOS inhibition protein A	-
E0E35_RS25820 (64979)	64979..65413	-	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
E0E35_RS25825 (65468)	65468..67426	-	1959	WP_112324844.1	ParB/RepB/Spo0J family partition protein	-
E0E35_RS25830 (67490)	67490..67723	-	234	WP_000005971.1	DUF905 domain-containing protein	-
E0E35_RS25835 (67779)	67779..68300	-	522	WP_033807850.1	single-stranded DNA-binding protein	-
E0E35_RS27035 (68599)	68599..69042	+	444	Protein_88	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	erm(B) / mph(A) / blaTEM-1B	-	1..76615	76615

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T288289 WP_001372321.1 NZ_LR213457:c63950-63825 [Shigella flexneri]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT288289 NZ_LR213457:c64251-64027 [Shigella flexneri]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGGATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin