Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 22292..22545 | Replicon | plasmid 3 |
| Accession | NZ_LR213457 | ||
| Organism | Shigella flexneri strain AUSMDU00008332 isolate AUSMDU00008332 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | E0E35_RS25540 | Protein ID | WP_001312851.1 |
| Coordinates | 22292..22441 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 22486..22545 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0E35_RS25500 (18314) | 18314..18715 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| E0E35_RS25505 (18648) | 18648..18905 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| E0E35_RS25510 (18998) | 18998..19651 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| E0E35_RS27025 (19749) | 19749..19889 | - | 141 | WP_001333237.1 | hypothetical protein | - |
| E0E35_RS25520 (20590) | 20590..21447 | - | 858 | WP_016240488.1 | incFII family plasmid replication initiator RepA | - |
| E0E35_RS25525 (21440) | 21440..21514 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| E0E35_RS25535 (21759) | 21759..22007 | - | 249 | WP_000083839.1 | replication regulatory protein RepA | - |
| E0E35_RS25540 (22292) | 22292..22441 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (22486) | 22486..22545 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (22486) | 22486..22545 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (22486) | 22486..22545 | + | 60 | NuclAT_1 | - | Antitoxin |
| - (22486) | 22486..22545 | + | 60 | NuclAT_1 | - | Antitoxin |
| E0E35_RS25550 (22688) | 22688..23161 | - | 474 | WP_016240489.1 | hypothetical protein | - |
| E0E35_RS25555 (23316) | 23316..23906 | - | 591 | WP_033807967.1 | DUF2726 domain-containing protein | - |
| E0E35_RS25560 (23944) | 23944..24153 | - | 210 | WP_001298565.1 | hemolysin expression modulator Hha | - |
| E0E35_RS25565 (24199) | 24199..24660 | - | 462 | WP_001233850.1 | thermonuclease family protein | - |
| E0E35_RS25570 (24906) | 24906..25118 | - | 213 | WP_001301409.1 | ANR family transcriptional regulator | - |
| E0E35_RS25575 (25250) | 25250..25810 | - | 561 | WP_033807966.1 | fertility inhibition protein FinO | - |
| E0E35_RS25580 (25865) | 25865..26611 | - | 747 | WP_000205718.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | erm(B) / mph(A) / blaTEM-1B | - | 1..76615 | 76615 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T288285 WP_001312851.1 NZ_LR213457:c22441-22292 [Shigella flexneri]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT288285 NZ_LR213457:22486-22545 [Shigella flexneri]
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
