Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3689367..3690061 | Replicon | chromosome |
Accession | NZ_LR213455 | ||
Organism | Shigella flexneri strain AUSMDU00008332 isolate AUSMDU00008332 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q0T7Q5 |
Locus tag | E0E35_RS19295 | Protein ID | WP_001263491.1 |
Coordinates | 3689367..3689765 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | Q0T7Q4 |
Locus tag | E0E35_RS19300 | Protein ID | WP_000554759.1 |
Coordinates | 3689768..3690061 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E0E35_RS19270 (3684706) | 3684706..3685164 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
E0E35_RS19275 (3685426) | 3685426..3686883 | + | 1458 | WP_001293030.1 | cytosol nonspecific dipeptidase | - |
E0E35_RS19280 (3686940) | 3686940..3687554 | - | 615 | Protein_3665 | peptide chain release factor H | - |
E0E35_RS19285 (3687616) | 3687616..3688659 | - | 1044 | WP_005053205.1 | RNA ligase RtcB family protein | - |
E0E35_RS19290 (3688905) | 3688905..3689357 | - | 453 | WP_001059860.1 | GNAT family N-acetyltransferase | - |
E0E35_RS19295 (3689367) | 3689367..3689765 | - | 399 | WP_001263491.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
E0E35_RS19300 (3689768) | 3689768..3690061 | - | 294 | WP_000554759.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
E0E35_RS19305 (3690113) | 3690113..3691168 | - | 1056 | WP_001226172.1 | DNA polymerase IV | - |
E0E35_RS19310 (3691239) | 3691239..3692024 | - | 786 | WP_000207560.1 | putative lateral flagellar export/assembly protein LafU | - |
E0E35_RS19315 (3691996) | 3691996..3693708 | + | 1713 | Protein_3672 | flagellar biosynthesis protein FlhA | - |
E0E35_RS19320 (3693925) | 3693925..3694422 | - | 498 | WP_000006251.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | gtrII / gtrB / gtrA | 3648243..3696981 | 48738 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15457.86 Da Isoelectric Point: 8.0949
>T288279 WP_001263491.1 NZ_LR213455:c3689765-3689367 [Shigella flexneri]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TPK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TR46 |