Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3602021..3602865 | Replicon | chromosome |
Accession | NZ_LR213455 | ||
Organism | Shigella flexneri strain AUSMDU00008332 isolate AUSMDU00008332 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | - |
Locus tag | E0E35_RS18835 | Protein ID | WP_014532172.1 |
Coordinates | 3602404..3602865 (+) | Length | 154 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | A5H0K0 |
Locus tag | E0E35_RS18825 | Protein ID | WP_005053053.1 |
Coordinates | 3602021..3602332 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E0E35_RS18800 (3597492) | 3597492..3597989 | + | 498 | Protein_3575 | COX aromatic rich motif-containing protein | - |
E0E35_RS18805 (3598011) | 3598011..3600002 | + | 1992 | Protein_3576 | cytochrome o ubiquinol oxidase subunit I | - |
E0E35_RS18810 (3599992) | 3599992..3600606 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
E0E35_RS18815 (3600606) | 3600606..3600935 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
E0E35_RS18820 (3600947) | 3600947..3601837 | + | 891 | WP_000971346.1 | heme o synthase | - |
E0E35_RS18825 (3602021) | 3602021..3602332 | + | 312 | WP_005053053.1 | DUF1778 domain-containing protein | Antitoxin |
E0E35_RS18835 (3602404) | 3602404..3602865 | + | 462 | WP_014532172.1 | GNAT family N-acetyltransferase | Toxin |
E0E35_RS18845 (3603761) | 3603761..3605914 | + | 2154 | WP_005060811.1 | SEL1-like repeat protein | - |
E0E35_RS18850 (3605967) | 3605967..3607697 | + | 1731 | WP_000645013.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 3602913..3603416 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 154 a.a. Molecular weight: 16623.52 Da Isoelectric Point: 9.9538
>T288278 WP_014532172.1 NZ_LR213455:3602404-3602865 [Shigella flexneri]
MIAVTLLSINLYALRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLERQRVSGVLQGSQPSEIGVVRLVMLGGAR
KYQKRGFGQDLLCDFFEHVKKIHPALPIKGVYLDADPAAINFYARLGFVQLSATPNAFGAVPMFLAIQHILAA
MIAVTLLSINLYALRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLERQRVSGVLQGSQPSEIGVVRLVMLGGAR
KYQKRGFGQDLLCDFFEHVKKIHPALPIKGVYLDADPAAINFYARLGFVQLSATPNAFGAVPMFLAIQHILAA
Download Length: 462 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|