Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3565086..3565704 | Replicon | chromosome |
Accession | NZ_LR213455 | ||
Organism | Shigella flexneri strain AUSMDU00008332 isolate AUSMDU00008332 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | E0E35_RS18635 | Protein ID | WP_001291435.1 |
Coordinates | 3565486..3565704 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | Q0T7C3 |
Locus tag | E0E35_RS18630 | Protein ID | WP_000344797.1 |
Coordinates | 3565086..3565460 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E0E35_RS18620 (3560175) | 3560175..3561368 | + | 1194 | WP_011069267.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
E0E35_RS18625 (3561391) | 3561391..3564540 | + | 3150 | WP_001132484.1 | efflux RND transporter permease AcrB | - |
E0E35_RS18630 (3565086) | 3565086..3565460 | + | 375 | WP_000344797.1 | Hha toxicity modulator TomB | Antitoxin |
E0E35_RS18635 (3565486) | 3565486..3565704 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
E0E35_RS18640 (3565876) | 3565876..3566427 | + | 552 | Protein_3544 | maltose O-acetyltransferase | - |
E0E35_RS18645 (3566543) | 3566543..3567013 | + | 471 | WP_000136192.1 | YlaC family protein | - |
E0E35_RS18650 (3567177) | 3567177..3568727 | + | 1551 | WP_005098218.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
E0E35_RS18655 (3568769) | 3568769..3569122 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
E0E35_RS18665 (3569501) | 3569501..3569812 | + | 312 | WP_000409911.1 | MGMT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 3569842..3571170 | 1328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T288277 WP_001291435.1 NZ_LR213455:3565486-3565704 [Shigella flexneri]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14513.38 Da Isoelectric Point: 4.9091
>AT288277 WP_000344797.1 NZ_LR213455:3565086-3565460 [Shigella flexneri]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQALQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQALQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TPD8 |