Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2514192..2514417 Replicon chromosome
Accession NZ_LR213455
Organism Shigella flexneri strain AUSMDU00008332 isolate AUSMDU00008332

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag E0E35_RS13075 Protein ID WP_000813254.1
Coordinates 2514192..2514347 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2514359..2514417 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E0E35_RS13035 2509318..2509878 - 561 WP_072075205.1 ORF6N domain-containing protein -
E0E35_RS13045 2511089..2511262 - 174 WP_000504450.1 hypothetical protein -
E0E35_RS13050 2511415..2511969 - 555 WP_000640143.1 DUF1133 family protein -
E0E35_RS13055 2511966..2512256 - 291 WP_073828270.1 DUF1364 domain-containing protein -
E0E35_RS13060 2512256..2512855 - 600 WP_000940329.1 DUF1367 family protein -
E0E35_RS13065 2512989..2513686 + 698 WP_225620329.1 IS1 family transposase -
E0E35_RS13075 2514192..2514347 - 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
- 2514359..2514417 + 59 - - Antitoxin
E0E35_RS13080 2514802..2515167 - 366 WP_000610655.1 DUF551 domain-containing protein -
E0E35_RS13085 2515167..2515832 - 666 WP_000208062.1 hypothetical protein -
E0E35_RS13090 2515829..2516194 - 366 WP_001229297.1 HNH endonuclease signature motif containing protein -
E0E35_RS13095 2516196..2516414 - 219 WP_000256998.1 DUF4014 family protein -
E0E35_RS13100 2516507..2516863 - 357 WP_005048249.1 hypothetical protein -
E0E35_RS13105 2516921..2517343 - 423 WP_001118168.1 DUF977 family protein -
E0E35_RS13110 2517358..2518104 - 747 WP_000788996.1 ATP-binding protein -
E0E35_RS26760 2518250..2518419 - 170 Protein_2486 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage sitABCD ipaH9.8 2456640..2526430 69790


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T288275 WP_000813254.1 NZ_LR213455:c2514347-2514192 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT288275 NZ_LR213455:2514359-2514417 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References