Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2514192..2514417 | Replicon | chromosome |
| Accession | NZ_LR213455 | ||
| Organism | Shigella flexneri strain AUSMDU00008332 isolate AUSMDU00008332 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | E0E35_RS13075 | Protein ID | WP_000813254.1 |
| Coordinates | 2514192..2514347 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2514359..2514417 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0E35_RS13035 | 2509318..2509878 | - | 561 | WP_072075205.1 | ORF6N domain-containing protein | - |
| E0E35_RS13045 | 2511089..2511262 | - | 174 | WP_000504450.1 | hypothetical protein | - |
| E0E35_RS13050 | 2511415..2511969 | - | 555 | WP_000640143.1 | DUF1133 family protein | - |
| E0E35_RS13055 | 2511966..2512256 | - | 291 | WP_073828270.1 | DUF1364 domain-containing protein | - |
| E0E35_RS13060 | 2512256..2512855 | - | 600 | WP_000940329.1 | DUF1367 family protein | - |
| E0E35_RS13065 | 2512989..2513686 | + | 698 | WP_225620329.1 | IS1 family transposase | - |
| E0E35_RS13075 | 2514192..2514347 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 2514359..2514417 | + | 59 | - | - | Antitoxin |
| E0E35_RS13080 | 2514802..2515167 | - | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
| E0E35_RS13085 | 2515167..2515832 | - | 666 | WP_000208062.1 | hypothetical protein | - |
| E0E35_RS13090 | 2515829..2516194 | - | 366 | WP_001229297.1 | HNH endonuclease signature motif containing protein | - |
| E0E35_RS13095 | 2516196..2516414 | - | 219 | WP_000256998.1 | DUF4014 family protein | - |
| E0E35_RS13100 | 2516507..2516863 | - | 357 | WP_005048249.1 | hypothetical protein | - |
| E0E35_RS13105 | 2516921..2517343 | - | 423 | WP_001118168.1 | DUF977 family protein | - |
| E0E35_RS13110 | 2517358..2518104 | - | 747 | WP_000788996.1 | ATP-binding protein | - |
| E0E35_RS26760 | 2518250..2518419 | - | 170 | Protein_2486 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | sitABCD | ipaH9.8 | 2456640..2526430 | 69790 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T288275 WP_000813254.1 NZ_LR213455:c2514347-2514192 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT288275 NZ_LR213455:2514359-2514417 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|