Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 1908905..1909130 Replicon chromosome
Accession NZ_LR213455
Organism Shigella flexneri strain AUSMDU00008332 isolate AUSMDU00008332

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag E0E35_RS09600 Protein ID WP_000813254.1
Coordinates 1908975..1909130 (+) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 1908905..1908963 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E0E35_RS09555 1904082..1905344 - 1263 Protein_1825 tyrosine-type recombinase/integrase -
E0E35_RS09565 1905682..1906479 - 798 WP_001325918.1 DgsA anti-repressor MtfA -
E0E35_RS09575 1906690..1907740 - 1051 Protein_1827 tyrosine-type recombinase/integrase -
E0E35_RS09580 1907740..1907880 - 141 Protein_1828 DUF4224 domain-containing protein -
E0E35_RS09585 1907907..1908323 + 417 WP_005069274.1 hypothetical protein -
- 1908905..1908963 - 59 - - Antitoxin
E0E35_RS09600 1908975..1909130 + 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
E0E35_RS09610 1909298..1909576 + 279 WP_011069426.1 hypothetical protein -
E0E35_RS09615 1909578..1910636 + 1059 WP_001265248.1 DUF968 domain-containing protein -
E0E35_RS09620 1910637..1911002 + 366 WP_000140020.1 RusA family crossover junction endodeoxyribonuclease -
E0E35_RS09625 1910999..1911687 + 689 Protein_1834 bacteriophage antitermination protein Q -
E0E35_RS09655 1912483..1912698 + 216 WP_000839572.1 class II holin family protein -
E0E35_RS09660 1912797..1913471 + 675 WP_004967157.1 IS66-like element accessory protein TnpA -
E0E35_RS09665 1913468..1913818 + 351 WP_005049241.1 IS66 family insertion sequence element accessory protein TnpB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - ipaH9.8 1900774..1940980 40206


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T288269 WP_000813254.1 NZ_LR213455:1908975-1909130 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT288269 NZ_LR213455:c1908963-1908905 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References