Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1908905..1909130 | Replicon | chromosome |
| Accession | NZ_LR213455 | ||
| Organism | Shigella flexneri strain AUSMDU00008332 isolate AUSMDU00008332 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | E0E35_RS09600 | Protein ID | WP_000813254.1 |
| Coordinates | 1908975..1909130 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 1908905..1908963 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0E35_RS09555 | 1904082..1905344 | - | 1263 | Protein_1825 | tyrosine-type recombinase/integrase | - |
| E0E35_RS09565 | 1905682..1906479 | - | 798 | WP_001325918.1 | DgsA anti-repressor MtfA | - |
| E0E35_RS09575 | 1906690..1907740 | - | 1051 | Protein_1827 | tyrosine-type recombinase/integrase | - |
| E0E35_RS09580 | 1907740..1907880 | - | 141 | Protein_1828 | DUF4224 domain-containing protein | - |
| E0E35_RS09585 | 1907907..1908323 | + | 417 | WP_005069274.1 | hypothetical protein | - |
| - | 1908905..1908963 | - | 59 | - | - | Antitoxin |
| E0E35_RS09600 | 1908975..1909130 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| E0E35_RS09610 | 1909298..1909576 | + | 279 | WP_011069426.1 | hypothetical protein | - |
| E0E35_RS09615 | 1909578..1910636 | + | 1059 | WP_001265248.1 | DUF968 domain-containing protein | - |
| E0E35_RS09620 | 1910637..1911002 | + | 366 | WP_000140020.1 | RusA family crossover junction endodeoxyribonuclease | - |
| E0E35_RS09625 | 1910999..1911687 | + | 689 | Protein_1834 | bacteriophage antitermination protein Q | - |
| E0E35_RS09655 | 1912483..1912698 | + | 216 | WP_000839572.1 | class II holin family protein | - |
| E0E35_RS09660 | 1912797..1913471 | + | 675 | WP_004967157.1 | IS66-like element accessory protein TnpA | - |
| E0E35_RS09665 | 1913468..1913818 | + | 351 | WP_005049241.1 | IS66 family insertion sequence element accessory protein TnpB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | ipaH9.8 | 1900774..1940980 | 40206 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T288269 WP_000813254.1 NZ_LR213455:1908975-1909130 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT288269 NZ_LR213455:c1908963-1908905 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|