Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 25921..26174 | Replicon | plasmid 2 |
| Accession | NZ_LR213453 | ||
| Organism | Shigella flexneri strain AUSMDU00008355 isolate AUSMDU00008355 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | E0E33_RS23045 | Protein ID | WP_001312851.1 |
| Coordinates | 25921..26070 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 26115..26174 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0E33_RS23005 | 21943..22344 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| E0E33_RS23010 | 22277..22534 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| E0E33_RS23015 | 22627..23280 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| E0E33_RS23025 | 24219..25076 | - | 858 | WP_016240488.1 | incFII family plasmid replication initiator RepA | - |
| E0E33_RS23030 | 25069..25143 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| E0E33_RS23040 | 25388..25636 | - | 249 | WP_000083839.1 | replication regulatory protein RepA | - |
| E0E33_RS23045 | 25921..26070 | - | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 26115..26174 | + | 60 | NuclAT_1 | - | Antitoxin |
| - | 26115..26174 | + | 60 | NuclAT_1 | - | Antitoxin |
| - | 26115..26174 | + | 60 | NuclAT_1 | - | Antitoxin |
| - | 26115..26174 | + | 60 | NuclAT_1 | - | Antitoxin |
| E0E33_RS23055 | 26317..26790 | - | 474 | WP_016240489.1 | hypothetical protein | - |
| E0E33_RS23060 | 26945..27535 | - | 591 | WP_033807967.1 | DUF2726 domain-containing protein | - |
| E0E33_RS23065 | 27573..27782 | - | 210 | WP_001298565.1 | hemolysin expression modulator Hha | - |
| E0E33_RS23070 | 27828..28289 | - | 462 | WP_001233850.1 | thermonuclease family protein | - |
| E0E33_RS23075 | 28535..28747 | - | 213 | WP_001301409.1 | ANR family transcriptional regulator | - |
| E0E33_RS23080 | 28879..29439 | - | 561 | WP_033807966.1 | fertility inhibition protein FinO | - |
| E0E33_RS23085 | 29494..30240 | - | 747 | WP_000205718.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | erm(B) / mph(A) / sul1 / qacE / aadA5 / blaTEM-1B | - | 1..82887 | 82887 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T288257 WP_001312851.1 NZ_LR213453:c26070-25921 [Shigella flexneri]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
Antitoxin
Download Length: 60 bp
>AT288257 NZ_LR213453:26115-26174 [Shigella flexneri]
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|