Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 25921..26174 Replicon plasmid 2
Accession NZ_LR213453
Organism Shigella flexneri strain AUSMDU00008355 isolate AUSMDU00008355

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag E0E33_RS23045 Protein ID WP_001312851.1
Coordinates 25921..26070 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 26115..26174 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E0E33_RS23005 21943..22344 - 402 WP_001398199.1 type II toxin-antitoxin system toxin endoribonuclease PemK -
E0E33_RS23010 22277..22534 - 258 WP_000557619.1 type II toxin-antitoxin system antitoxin PemI -
E0E33_RS23015 22627..23280 - 654 WP_000616807.1 CPBP family intramembrane metalloprotease -
E0E33_RS23025 24219..25076 - 858 WP_016240488.1 incFII family plasmid replication initiator RepA -
E0E33_RS23030 25069..25143 - 75 WP_001365705.1 RepA leader peptide Tap -
E0E33_RS23040 25388..25636 - 249 WP_000083839.1 replication regulatory protein RepA -
E0E33_RS23045 25921..26070 - 150 WP_001312851.1 type I toxin-antitoxin system Hok family toxin Toxin
- 26115..26174 + 60 NuclAT_1 - Antitoxin
- 26115..26174 + 60 NuclAT_1 - Antitoxin
- 26115..26174 + 60 NuclAT_1 - Antitoxin
- 26115..26174 + 60 NuclAT_1 - Antitoxin
E0E33_RS23055 26317..26790 - 474 WP_016240489.1 hypothetical protein -
E0E33_RS23060 26945..27535 - 591 WP_033807967.1 DUF2726 domain-containing protein -
E0E33_RS23065 27573..27782 - 210 WP_001298565.1 hemolysin expression modulator Hha -
E0E33_RS23070 27828..28289 - 462 WP_001233850.1 thermonuclease family protein -
E0E33_RS23075 28535..28747 - 213 WP_001301409.1 ANR family transcriptional regulator -
E0E33_RS23080 28879..29439 - 561 WP_033807966.1 fertility inhibition protein FinO -
E0E33_RS23085 29494..30240 - 747 WP_000205718.1 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid erm(B) / mph(A) / sul1 / qacE / aadA5 / blaTEM-1B - 1..82887 82887


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T288257 WP_001312851.1 NZ_LR213453:c26070-25921 [Shigella flexneri]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

Antitoxin


Download         Length: 60 bp

>AT288257 NZ_LR213453:26115-26174 [Shigella flexneri]
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTTGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References