Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3472534..3473228 | Replicon | chromosome |
Accession | NZ_LR213452 | ||
Organism | Shigella flexneri strain AUSMDU00008355 isolate AUSMDU00008355 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q0T7Q5 |
Locus tag | E0E33_RS18090 | Protein ID | WP_001263491.1 |
Coordinates | 3472830..3473228 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | Q0T7Q4 |
Locus tag | E0E33_RS18085 | Protein ID | WP_000554759.1 |
Coordinates | 3472534..3472827 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E0E33_RS18065 | 3468312..3468833 | + | 522 | Protein_3438 | C40 family peptidase | - |
E0E33_RS18070 | 3468887..3470599 | - | 1713 | Protein_3439 | flagellar biosynthesis protein FlhA | - |
E0E33_RS18075 | 3470571..3471356 | + | 786 | WP_000207560.1 | putative lateral flagellar export/assembly protein LafU | - |
E0E33_RS18080 | 3471427..3472482 | + | 1056 | WP_001226172.1 | DNA polymerase IV | - |
E0E33_RS18085 | 3472534..3472827 | + | 294 | WP_000554759.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
E0E33_RS18090 | 3472830..3473228 | + | 399 | WP_001263491.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
E0E33_RS18095 | 3473238..3473690 | + | 453 | WP_001059846.1 | GNAT family N-acetyltransferase | - |
E0E33_RS18100 | 3473936..3474979 | + | 1044 | WP_005060486.1 | RNA ligase RtcB family protein | - |
E0E33_RS18105 | 3475041..3475655 | + | 615 | Protein_3446 | peptide chain release factor H | - |
E0E33_RS18110 | 3475712..3477169 | - | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
E0E33_RS18115 | 3477431..3477889 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | gtrB | 3466450..3513013 | 46563 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15457.86 Da Isoelectric Point: 8.0949
>T288256 WP_001263491.1 NZ_LR213452:3472830-3473228 [Shigella flexneri]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TPK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TR46 |