Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3391374..3392218 | Replicon | chromosome |
Accession | NZ_LR213452 | ||
Organism | Shigella flexneri strain AUSMDU00008355 isolate AUSMDU00008355 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | A0A4P7TPN5 |
Locus tag | E0E33_RS17675 | Protein ID | WP_005060796.1 |
Coordinates | 3391820..3392218 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | A5H0K0 |
Locus tag | E0E33_RS17665 | Protein ID | WP_005053053.1 |
Coordinates | 3391374..3391685 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E0E33_RS17640 | 3386844..3387341 | + | 498 | Protein_3352 | COX aromatic rich motif-containing protein | - |
E0E33_RS17645 | 3387363..3389354 | + | 1992 | Protein_3353 | cytochrome o ubiquinol oxidase subunit I | - |
E0E33_RS17650 | 3389344..3389958 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
E0E33_RS17655 | 3389958..3390287 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
E0E33_RS17660 | 3390299..3391189 | + | 891 | WP_000971356.1 | heme o synthase | - |
E0E33_RS17665 | 3391374..3391685 | + | 312 | WP_005053053.1 | DUF1778 domain-containing protein | Antitoxin |
E0E33_RS17670 | 3391669..3391827 | + | 159 | WP_005053055.1 | hypothetical protein | - |
E0E33_RS17675 | 3391820..3392218 | + | 399 | WP_005060796.1 | GNAT family N-acetyltransferase | Toxin |
E0E33_RS17680 | 3392266..3392963 | - | 698 | Protein_3360 | IS1 family transposase | - |
E0E33_RS17685 | 3393114..3395267 | + | 2154 | WP_005060811.1 | SEL1-like repeat protein | - |
E0E33_RS17690 | 3395320..3397050 | + | 1731 | WP_000645011.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 3392266..3392769 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14335.69 Da Isoelectric Point: 9.1674
>T288255 WP_005060796.1 NZ_LR213452:3391820-3392218 [Shigella flexneri]
VRNSDCAAKALIDRQSGELIGICTFTAYSLERQRVSGVLQGSQPSEIGVVRLVMLGGARKYQKRGFGQDLLCDFFEHVKK
IHPALPIKGVYLDADPAAINFYARLGFVQLSATPNAFGAVPMFLAIQHILAA
VRNSDCAAKALIDRQSGELIGICTFTAYSLERQRVSGVLQGSQPSEIGVVRLVMLGGARKYQKRGFGQDLLCDFFEHVKK
IHPALPIKGVYLDADPAAINFYARLGFVQLSATPNAFGAVPMFLAIQHILAA
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TPN5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A5H0K0 |