Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3354418..3355036 | Replicon | chromosome |
Accession | NZ_LR213452 | ||
Organism | Shigella flexneri strain AUSMDU00008355 isolate AUSMDU00008355 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | E0E33_RS17470 | Protein ID | WP_001291435.1 |
Coordinates | 3354818..3355036 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | Q0T7C3 |
Locus tag | E0E33_RS17465 | Protein ID | WP_000344797.1 |
Coordinates | 3354418..3354792 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E0E33_RS17455 | 3349507..3350700 | + | 1194 | WP_024260158.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
E0E33_RS17460 | 3350723..3353872 | + | 3150 | WP_001132485.1 | multidrug efflux RND transporter permease subunit | - |
E0E33_RS17465 | 3354418..3354792 | + | 375 | WP_000344797.1 | Hha toxicity modulator TomB | Antitoxin |
E0E33_RS17470 | 3354818..3355036 | + | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
E0E33_RS17475 | 3355208..3355759 | + | 552 | WP_000102577.1 | maltose O-acetyltransferase | - |
E0E33_RS17480 | 3355875..3356345 | + | 471 | WP_000136192.1 | YlaC family protein | - |
E0E33_RS17485 | 3356509..3358059 | + | 1551 | WP_005106783.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
E0E33_RS17490 | 3358101..3358454 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
E0E33_RS17500 | 3358833..3359144 | + | 312 | WP_000409911.1 | MGMT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 3359174..3360502 | 1328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T288253 WP_001291435.1 NZ_LR213452:3354818-3355036 [Shigella flexneri]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14513.38 Da Isoelectric Point: 4.9091
>AT288253 WP_000344797.1 NZ_LR213452:3354418-3354792 [Shigella flexneri]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQALQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQALQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P7TPD8 |