Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2381702..2381927 Replicon chromosome
Accession NZ_LR213452
Organism Shigella flexneri strain AUSMDU00008355 isolate AUSMDU00008355

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag E0E33_RS12275 Protein ID WP_000813254.1
Coordinates 2381702..2381857 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2381869..2381927 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E0E33_RS12235 2376828..2377334 - 507 WP_045178261.1 ORF6N domain-containing protein -
E0E33_RS12245 2378599..2378784 - 186 WP_005049799.1 hypothetical protein -
E0E33_RS12250 2378925..2379479 - 555 WP_000640143.1 DUF1133 family protein -
E0E33_RS12255 2379476..2379766 - 291 WP_000228038.1 DUF1364 domain-containing protein -
E0E33_RS12260 2379766..2380365 - 600 WP_000940329.1 DUF1367 family protein -
E0E33_RS12265 2380499..2381196 + 698 Protein_2334 IS1 family transposase -
E0E33_RS12275 2381702..2381857 - 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
- 2381869..2381927 + 59 - - Antitoxin
E0E33_RS12280 2382312..2382677 - 366 WP_000610655.1 DUF551 domain-containing protein -
E0E33_RS12285 2382677..2383342 - 666 WP_000208062.1 hypothetical protein -
E0E33_RS12290 2383339..2383704 - 366 WP_001229298.1 HNH endonuclease -
E0E33_RS12295 2383706..2383924 - 219 WP_000256998.1 DUF4014 family protein -
E0E33_RS12300 2384017..2384373 - 357 WP_005048249.1 hypothetical protein -
E0E33_RS12305 2384431..2384853 - 423 WP_001118167.1 DUF977 family protein -
E0E33_RS12310 2384868..2385611 - 744 WP_000788999.1 ATP-binding protein -
E0E33_RS24035 2386104..2386358 - 255 Protein_2343 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2368005..2389841 21836


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T288250 WP_000813254.1 NZ_LR213452:c2381857-2381702 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT288250 NZ_LR213452:2381869-2381927 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References