Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2381702..2381927 | Replicon | chromosome |
| Accession | NZ_LR213452 | ||
| Organism | Shigella flexneri strain AUSMDU00008355 isolate AUSMDU00008355 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | E0E33_RS12275 | Protein ID | WP_000813254.1 |
| Coordinates | 2381702..2381857 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2381869..2381927 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0E33_RS12235 | 2376828..2377334 | - | 507 | WP_045178261.1 | ORF6N domain-containing protein | - |
| E0E33_RS12245 | 2378599..2378784 | - | 186 | WP_005049799.1 | hypothetical protein | - |
| E0E33_RS12250 | 2378925..2379479 | - | 555 | WP_000640143.1 | DUF1133 family protein | - |
| E0E33_RS12255 | 2379476..2379766 | - | 291 | WP_000228038.1 | DUF1364 domain-containing protein | - |
| E0E33_RS12260 | 2379766..2380365 | - | 600 | WP_000940329.1 | DUF1367 family protein | - |
| E0E33_RS12265 | 2380499..2381196 | + | 698 | Protein_2334 | IS1 family transposase | - |
| E0E33_RS12275 | 2381702..2381857 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 2381869..2381927 | + | 59 | - | - | Antitoxin |
| E0E33_RS12280 | 2382312..2382677 | - | 366 | WP_000610655.1 | DUF551 domain-containing protein | - |
| E0E33_RS12285 | 2382677..2383342 | - | 666 | WP_000208062.1 | hypothetical protein | - |
| E0E33_RS12290 | 2383339..2383704 | - | 366 | WP_001229298.1 | HNH endonuclease | - |
| E0E33_RS12295 | 2383706..2383924 | - | 219 | WP_000256998.1 | DUF4014 family protein | - |
| E0E33_RS12300 | 2384017..2384373 | - | 357 | WP_005048249.1 | hypothetical protein | - |
| E0E33_RS12305 | 2384431..2384853 | - | 423 | WP_001118167.1 | DUF977 family protein | - |
| E0E33_RS12310 | 2384868..2385611 | - | 744 | WP_000788999.1 | ATP-binding protein | - |
| E0E33_RS24035 | 2386104..2386358 | - | 255 | Protein_2343 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2368005..2389841 | 21836 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T288250 WP_000813254.1 NZ_LR213452:c2381857-2381702 [Shigella flexneri]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT288250 NZ_LR213452:2381869-2381927 [Shigella flexneri]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|